CAZyme Information: M747DRAFT_357703-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_357703-t43_1-p1
• CAZy Family: GT2
• CAZyme Description: endo-rhamnogalacturonase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492	KZ851936|CGC1	53473.48	4.1699

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851936:309319-311136(+)

Full Sequence      

MRSILFILFSVFAGLAAGQLIGPVGPTTQLEDKDIECNILDYGGVADNETDVATSIETTF
TECVLNNPKSRLVIPEGDYLIKRSVVLSNGTNWAFQLDGLITAAYGGNWTVDRELILQGF
AGEQIINSTINGEGDGKFLLDVLVIVNAVDFEFYSSNGLGAFQGQGYIYRNLANTDRPRL
VRLISPTNASVHDLILVDSPKFHIVFDFAVNLEAYHLTIRGANLGSYDGIDAIGTNYYIH
DNEATVTNRDECVSVKSPSHHALVENLVCNQAGSGVSIGSLNVSAEISNIEARNISIIQG
NNIAFIKTYPGGSGYVKDVTFENFRSLNSLYGLDINQYWQNTWEPDTGSVTLSNLVFKNF
SGSVADGALRPPLYLFASDLTFATNVTVEEFSVWTETGTTVVNKISNIFGTGDDSYGEND
GIESLQSGESPYTYTSTYTITASPTNWQAPSTPTWALPSTGYGTASPIPVYTPAPLWRPG
GIDYNLHYWGSF

Enzyme Prediction     

No EC number prediction in M747DRAFT_357703-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	150	401	6.6e-46	0.7476923076923077

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	7.74e-23	160	393	61	303	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	9.46e-16	38	365	69	383	polygalacturonase ADPG
215540	PLN03010	1.33e-14	38	415	48	396	polygalacturonase
215426	PLN02793	1.84e-14	188	365	187	369	Probable polygalacturonase
227721	Pgu1	3.23e-14	38	336	84	405	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABD67157.1|GH28	0.0	1	492	1	455
ABD67155.1|GH28	0.0	1	492	1	455
CAK96548.1|GH28	0.0	1	492	1	474
QQK39531.1|GH28	4.31e-301	15	492	14	489
BAE57693.1|GH28	2.59e-290	1	492	1	487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	1.38e-84	19	485	1	418	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
1BHE_A	1.66e-06	83	367	40	345	Chain A, POLYGALACTURONASE [Pectobacterium carotovorum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QYE5|RHGA_ASPNC	1.41e-90	15	480	15	432	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|Q5ARE6|RHGA_EMENI	2.02e-90	15	485	14	436	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|P87160|RHGA_ASPNG	7.86e-90	15	480	15	432	Rhamnogalacturonase A OS=Aspergillus niger OX=5061 GN=rhgA PE=1 SV=1
sp|B8NKB9|RHGE_ASPFN	2.92e-87	18	485	21	443	Probable rhamnogalacturonase E OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgE PE=3 SV=2
sp|Q00001|RHGA_ASPAC	3.51e-86	1	485	1	436	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000232	0.999738	CS pos: 18-19. Pr: 0.9725

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_357703-t43_1-p1.