CAZyme Information: M747DRAFT_352245-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_352245-t43_1-p1
• CAZy Family: GH92
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
608	KZ851900|CGC2	66582.58	5.2784

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851900:94976-96865(+)

Full Sequence      

MTGLKSYDYIIVGAGIGGLVLASRLTEDADVRVLLIEAGANRMGDPRIETPGFLETLYGN
PDFDWDYMSEPQVHVNNRQIAQPRGRVVGGSSTMNFSVIMYPSEANFAAWKSLGNEGWGP
EDIAPYLRKFHTYTPPSEETAAFLSLDKYMKQENQGKDGPIPVTLPNVYGPFNQAWDETF
GHLGWRTDVDPISGRKIGAFTSPLSVDGATGRRGYAGAYFSPKVAERPNLDLLAETMVER
VLLTKDADGLATATGVQVKTKGEETREIVANREVIICAGSLNSPQILELSGIGKRDLLEK
HSIPVVVDRPGVGENLQDHCLAAVSFEVADGQISGDITRDPNVVQSLIKLYEETHSGPLA
GMPVSMAYLPLMDHDGRLSSEKVEELLTQHLDQHIKDAPTAQQQQYALQRELLQEGRNAS
AQYMFLPIQVHMNPGKTTMSDVLAKALPGNYITILVLHNHPFSRGSVHIRSANADDKPIY
DPNYLSHPLDIEILARHVQYLDQIAATEPFAGLLKPGSRLPERAIDLTDLEKTKEIVKER
LFTCFHPAGSCAMMPAELGGVVDSKLKVHGTRNLRVVDASVFPLEPAGNIQATTYAVAER
AADIIRGL

Enzyme Prediction     

No EC number prediction in M747DRAFT_352245-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	606	1e-180	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.41e-110	5	607	4	533	choline dehydrogenase; Validated
225186	BetA	9.04e-105	1	607	2	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	7.00e-44	461	601	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.32e-32	6	593	55	564	Protein HOTHEAD
366272	GMC_oxred_N	1.14e-29	75	319	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96255.1|AA3_2	0.0	1	608	1	608
BCR96633.1|AA3_2	0.0	1	608	1	608
UDD56791.1|AA3_2	1.49e-308	5	606	6	607
QMW28733.1|AA3_2	1.22e-307	5	606	6	607
QRD83267.1|AA3_2	1.22e-307	5	606	6	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	3.13e-82	6	606	5	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.30e-77	5	606	4	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	6.24e-69	7	606	2	562	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	9.05e-68	7	606	3	563	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6O9N_A	1.40e-57	7	605	36	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	6.47e-108	5	605	12	616	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	1.31e-103	7	606	14	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.31e-103	7	606	14	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.04e-80	6	606	39	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	1.35e-80	5	607	45	617	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.977976	0.022022

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_352245-t43_1-p1.