CAZyme Information: M747DRAFT_339228-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_339228-t43_1-p1
• CAZy Family: GH74
• CAZyme Description: fungal chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351		36447.99	3.5377

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851906:513963-515232(-)

Full Sequence      

MAFKTTAGLAFLALAGSVKAQSVDGSKYNSPSNGPPASYFAAATTLPVAALQSAAAKASS
VPSKATYPVNTDDDSPKSTIHSDWVKFNQGAALSWVADMDVDCDGIDYKCKGNGDGLPET
NWGALSAYEVPWIVIPDQFLTANEDLLPGNNVAAVICNGKMYYGILGDSNGDDPEVTGEA
SWLMARTCFPDDDLNGAEGHAEADVTYIVFTGDDAVLPSSALNKNYITNFSTLRSMGDKL
VGALASNLGLSGSSPSPSASVPSQTTLATSAATSAASTSSASGSTATCSWQGHCEGAICS
TEDDCSDDLVCDSGKCSSPDEDDGDDEDDEDEEENDEDDEDDDDEDDEDDE

Enzyme Prediction     

EC	3.2.1.132:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	46	242	1.8e-77	0.9863636363636363

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	3.16e-57	99	243	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12327.1|GH75	7.82e-196	1	323	1	327
BCS00558.1|GH75	7.82e-196	1	323	1	327
CAK49178.1|GH75	1.12e-192	1	324	1	290
ADG96019.1|GH75|3.2.1.132	1.96e-131	1	318	2	303
UDD61138.1|GH75	2.68e-131	12	318	14	306

PDB Hits     

M747DRAFT_339228-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q75R32|CSNC_ASPOZ	9.50e-131	12	318	14	306	Endo-chitosanase C OS=Aspergillus oryzae OX=5062 GN=csnC PE=1 SV=2
sp|Q2U5P1|CSNC_ASPOR	1.12e-126	12	318	14	315	Endo-chitosanase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnC PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	6.59e-22	97	244	77	243	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q2U3M5|CSN_ASPOR	6.59e-22	97	244	77	243	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q8NK76|CSNB_ASPOZ	3.00e-21	99	244	78	238	Endo-chitosanase B OS=Aspergillus oryzae OX=5062 GN=csnB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999740	CS pos: 20-21. Pr: 0.9777

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_339228-t43_1-p1.