CAZyme Information: M747DRAFT_332201-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_332201-t43_1-p1
• CAZy Family: GH67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
994		108643.41	4.4391

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851919:43476-46835(+)

Full Sequence      

MKLQSILSCWAILVAQIWATTDGLTDLVAWDPYSLTVNGNRLFVYSGEFHYPRLPVPEMW
LDVFQKMRAHGFNAVSLYFFWDYHSPINGTYDFETGAHNIQRLFDYAQEAGIYIIARAGP
YCNAEFNGGGLALYLSDGSGGELRTSDATYHQAWTPWIERIGKIIADNSITNGGPVILNQ
IENELQETTHSASNTLVEYMEQIEEAFRAAGVDVPFTSNEKGQRSRSWSTDYEDVGGAVN
VYGLDSYPGGLSCTNPSTGFSVLRNYYQWFQNTSYTQPEYLPEFEGGWFSAWGADSFYDQ
CTSELSPQFADVYYKNNIGQRVTLQNLYMLYGGTNWGHLAAPVVYTSYDYSAPLRETRQI
RDKLSQTKLVGLFTRVSSGLLGVEMEGNGTSYTSTTSAYTWVLRNPNTTAGFYVVQQDTT
SSQTDITFSLNVNTSAGAFTLPNINLQGRQSKVISTDYPLGHSTLLYVSTDIATYGTFGD
TDVVVLYARSGQVVSFAFKNTTKLTFEEYGDSVNLTSSSGNRTITSYTYTQGSGTSVVKF
SNGAIFYLVETETAFRFWAPPTTTDPYVTAEQQIFVLGPYLVRNVSISGSVVDLVGDNDN
ATTVEVFAGSPAKAVKWNGKEITVTKTDYGSLVGSIGGADSSSITIPSLTGWKVRDSLPE
IQSSYDDSKWTVCNKTTTLSPVDPLSLPVLFASDYGYYTGIKIYRGRFDGTNVTGANLTA
QGGLAFGWNVWLNGDLVASLPGDADETSSNAAIDFSNHTLKQTDNLLTVVIDYTGHDETS
TGDGVENPRGLLGATLNGGSFTSWKIQGNAGGAAGAYELDPVRAPMNEGGLLAERQGWHL
PGYKAKSSDGWTDGSPLDGLNKSGVAFYLTTFTLDLPKKYDVPLGIQFTSPSTVDPVRIQ
LFINGYQYGKYVPYLGPQTTFPIPPGIINNRDKNTIGLSLWAQTDAGAKLENIELISYGA
YESGFDAGNGTGFDLNGAKLGYQPEWTEARAKYT

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	35	370	2e-89	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	1.21e-86	34	371	1	315	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	5.15e-60	380	556	1	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	1.30e-40	380	557	2	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
166698	PLN03059	1.13e-36	28	399	30	377	beta-galactosidase; Provisional
404274	BetaGal_dom4_5	7.77e-34	833	946	2	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK44945.1|GH35	0.0	1	994	1	994
AOV94178.1|GH35	0.0	1	994	1	994
BCS13384.1|GH35	0.0	1	994	1	994
BCS01673.1|GH35	0.0	1	994	1	994
APA12177.1|GH35	0.0	1	993	1	983

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	2.97e-189	24	957	2	945	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
5IFP_A	3.25e-186	19	955	37	979	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	9.04e-186	19	955	37	979	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	9.17e-175	19	955	37	977	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
3OG2_A	2.61e-173	24	957	22	977	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UMD5|BGALC_ASPOR	0.0	16	966	20	965	Probable beta-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=lacC PE=3 SV=1
sp|A1DM65|BGALC_NEOFI	0.0	20	993	24	982	Probable beta-galactosidase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacC PE=3 SV=1
sp|B6H5X9|BGALC_PENRW	0.0	19	993	21	981	Probable beta-galactosidase C OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=lacC PE=3 SV=1
sp|A2QL84|BGALC_ASPNC	0.0	1	994	1	994	Probable beta-galactosidase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=lacC PE=3 SV=1
sp|Q4WNE4|BGALC_ASPFU	0.0	20	993	24	982	Probable beta-galactosidase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=lacC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000279	0.999699	CS pos: 23-24. Pr: 0.4715

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_332201-t43_1-p1.