CAZyme Information: M747DRAFT_330395-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_330395-t43_1-p1
• CAZy Family: GH55
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620		67686.95	5.9558

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851909:679002-680925(+)

Full Sequence      

MDTTPITDFIHDKFDFIIVGGGTAGLVLAARLSEDPNIRVGVIEAGLSRLGDPKVDTPTG
MAMTLKDPEYDWCFQTSPQSGVNNKTYATHRGKMLGGSSGFNFMMSGRPTEEEINDWGKA
TGVKGWEWSELLPYFKKHEMLEVDQPNIMSRDTNICPLEPGLHGTDGPIHHSFGTWHAPF
EKDLIPALDTVSGLSRPENPYAGNHLGFYRTLFTIDRTGKPVRSYAASGYLAPNAGRSNL
RVLTDALVCKVTLGTNEHSERQAMGVEFLHQGTSYTVRPRKEVILSAGTVQSPQLLELSG
VGDPNVLGRIGIPCIVPNMDVGNNLQEQALCSVVYELAPGYTSVDSLLRDHAIFAEHQKL
YEEEHTGALSGPLSITGYTPYATQIEKQDLEKTVACFLDPKNASTKQDTVLQNKQRKIIA
ARIQDPTCPCIQYMCAPENFDTARAVDNLGAVMPGPPSGFNDCYSITTSQMHPVSRGRVH
VVSDDPKQAPDISPGLLAHPADVDVLAAGVKFADRVFRSELIRDKVARRVRPDPGVDVGV
RDQAKEFVRENAVPFQHLVGTCALGMVVDERLRVKRVKGLRVVDASVVPMMVSPSLAAVV
YAVAEKAADLVKEDWGLVNE

Enzyme Prediction     

No EC number prediction in M747DRAFT_330395-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	614	5e-169	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.97e-93	10	614	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.09e-89	13	612	5	532	choline dehydrogenase; Validated
274888	Rv0697	2.37e-48	15	611	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	2.62e-33	473	607	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	8.99e-27	82	309	14	211	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAL00904.1|AA3_2	0.0	1	620	1	620
BCS03047.1|AA3_2	0.0	1	617	1	617
BCS14695.1|AA3_2	0.0	1	617	1	617
ATZ47931.1|AA3_2	1.42e-254	1	616	1	619
UBX54549.1|AA3_2	3.52e-240	1	615	1	611

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.17e-65	14	614	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.24e-65	14	614	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	8.35e-56	14	614	6	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.28e-55	10	614	2	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	1.38e-54	14	615	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	2.20e-241	1	614	1	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A142PTM2|CITC_MONPU	1.14e-236	1	616	1	613	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	1.14e-236	1	616	1	613	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.58e-85	5	614	29	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	8.22e-75	8	611	41	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999756	0.000274

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_330395-t43_1-p1.