CAZyme Information: M747DRAFT_327313-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_327313-t43_1-p1
• CAZy Family: GH51
• CAZyme Description: pectin lyase pela

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		39783.54	3.9128

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851899:680159-681515(+)

Full Sequence      

MKYSTIFSAAAAVFAGSAAAVGVSGSAEGFAEGVTGGGDATPVYPDTIDELVSYLGDDEA
RVIVLTKTFDFTDSEGTTTGTGCAPWGTASACQVAIDQDDWCENYEPDAPSISVEYYNAG
VLGITVTSNKSLIGEGSSGAIKGKGLRIVSGAENIIIQNIAVTDINPKYVWGGDAITLDD
CDLVWIDHVTTARIGRQHYVLGTSADNRVSLTNNYIDGVSDYSATCDGYHYWGIYLDGDA
DLVTMKGNYIYHTSGRSPKVQDNTLLHCVNNYFYDISGHAFEIGEGGYVLAEGNVFQNVD
TVLETYEGAAFTVPSTTAGEVCSTYLGRDCVINGFGSSGTFSEDSTSFLSDFEGKNIASA
SAYTSVASSVVANAGQGNL

Enzyme Prediction     

EC	4.2.2.10:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	114	298	1.1e-87	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	3.37e-56	116	300	4	190	Amb_all domain.
226384	PelB	2.38e-13	111	298	84	275	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	4.21e-11	124	296	30	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK48529.1|PL1_4|4.2.2.10	2.31e-276	1	379	1	379
AKA88528.1|PL1_4	3.28e-276	1	379	1	379
CAA43130.1|PL1_4|4.2.2.10	1.10e-274	1	379	1	379
ALB05716.1|PL1_4|4.2.2.10	3.37e-269	1	379	1	379
BCR99415.1|PL1_4	7.93e-268	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDJ_A	3.96e-264	21	379	1	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	2.45e-258	21	379	1	359	Pectin Lyase A [Aspergillus niger]
1QCX_A	2.58e-172	22	377	2	358	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2R3I1|PELA_ASPNC	4.10e-277	1	379	1	379	Probable pectin lyase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelA PE=3 SV=1
sp|Q01172|PELA_ASPNG	1.95e-275	1	379	1	379	Pectin lyase A OS=Aspergillus niger OX=5061 GN=pelA PE=1 SV=1
sp|Q5BAU9|PELA_EMENI	1.40e-206	1	375	1	376	Pectin lyase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelA PE=1 SV=2
sp|A1CYC2|PELA_NEOFI	1.91e-206	1	379	1	378	Probable pectin lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pelA PE=3 SV=2
sp|B0XT36|PELA_ASPFC	9.03e-205	1	379	1	378	Probable pectin lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000412	0.999578	CS pos: 20-21. Pr: 0.8371

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_327313-t43_1-p1.