CAZyme Information: M747DRAFT_327224-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_327224-t43_1-p1
• CAZy Family: GH51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1030		113680.50	5.1068

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851899:380479-383838(-)

Full Sequence      

MKTSFLLAIGLAVEACLGLVSAPNYVRQINATDSSLQDIVTWDEYSIRVRGERILLLLGE
FHPFRLPCPGLWLDVFQKVRALGFSAVSFYVDWALLEGERGSIRADGVFALEEFFQAATE
AGLYLTARPGPYINAEVSGGGFPGWLKRVQGRLKTTDQGYLDAITPYMQAIGRIIAKAQI
TNGGPVILFQPENEYTACVQDEGYTQVSNYSMPDINSSCLQKEYMAYVEEQYRKAGIVVP
FIVNDADPMGNFAPGTGVGAVDIYSFDDYPLQWSTAPSNPSNWSSLISPLLSYNETVHEE
QSPTTPFSISEFQGGVPDAWGGVGIETSAAYIGPEFERIFYKINYGFRAAIQNLYMIFGG
TNWGNLGHSGGYTSYDVGAAIAEDRQVIREKYSELKLQSNFLQASSAYLETHSDNGSYGI
YTDATSLAVTRLAGNPTNFYVVRHGELTSRESTSYKLRVNTSAGNLAIPQLSGSLSLHGR
DSKIHLVDYNVGNVSLIYSTAELFTWKQAGSKSVVVLYGGEDELHEFAVPANKGKPTSIE
GDGLQVQQINSTTVIQWAVQPSRRVVHFSDTLEVHLLWRNEAYNYWVLDLPVPGAIGRHV
SRSHTNRSVIVKAGYLLRTAEIIGTSLYLTGDINTTTTIELISAPQPVTSILFNKNRIPT
TITSPGRLTGTLTYHKPNISLPDLTTLDWYYLNTLPEVHDPTYDDHLWTPCTHTTTANPR
NLTTPTSLYASDYGYNGGTLLYRGTFTATGNETSLYLLTEGGYAYGHSIWLNNTFLASWP
GNPAFLLSNQTITFPSPLTPGTTYKLTILIDHLGNDENFPANGEFMKDPRGILDYTLHGR
DDKSAISWKMTGNFGGESYADLSRGPLNEGALFAERKGYHLPGAPTEQWTKRSPFDGLPE
DERPGVGFFATKFDLQIPDGYDVPISVVFENSTMAGDGSGPARFRSELFVNGWQFGKYVN
HIGPQLSYPVPEGILNYNGSNYLALTIWAMDEKSFKLDGLRLQANAVVQSGYRKPSLVKG
EVYKERVDSY

Enzyme Prediction     

EC	3.2.1.23:18	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	49	397	1.7e-85	0.9771986970684039

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	2.98e-96	51	397	6	313	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	4.55e-69	411	584	2	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	9.31e-53	414	585	7	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	8.01e-35	873	992	1	110	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
404274	BetaGal_dom4_5	6.07e-28	703	816	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOV94180.1|GH35	0.0	1	1030	1	1030
CAK42143.1|GH35	0.0	1	1030	1	1015
BCR99524.1|GH35	0.0	1	1030	1	1029
BCS11821.1|GH35	0.0	1	1030	1	1029
APA06011.1|GH35	0.0	36	1030	39	1017

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	0.0	36	1030	2	971	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
4IUG_A	0.0	36	1030	42	1005	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]
5IFP_A	0.0	1	1030	1	1007	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	0.0	1	1030	1	1007	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
3OG2_A	2.52e-317	36	1030	22	1003	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XMP7|BGALA_ASPFC	0.0	36	1030	42	1006	Probable beta-galactosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacA PE=3 SV=2
sp|A1D1Z9|BGALA_NEOFI	0.0	36	1030	42	1006	Probable beta-galactosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacA PE=3 SV=1
sp|A1DJ58|BGALE_NEOFI	0.0	5	1030	3	1011	Probable beta-galactosidase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=lacE PE=3 SV=1
sp|A2QAN3|BGALA_ASPNC	0.0	1	1030	1	1007	Beta-galactosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=lacA PE=1 SV=1
sp|B8QGZ3|BGALA_PENEN	0.0	36	1030	42	1011	Probable beta-galactosidase A OS=Penicillium expansum OX=27334 GN=lacA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000655	0.999328	CS pos: 18-19. Pr: 0.9406

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_327224-t43_1-p1.