CAZyme Information: M747DRAFT_325151-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_325151-t43_1-p1
• CAZy Family: GH5
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		59260.03	5.0725

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851933:314125-316043(-)

Full Sequence      

MPSADLTSSPEDFLTQTYDYLIIGGGTAGLVVASRLSANPDVRVGVIEAGDAGFDDPNFT
NPGKISAMLHNPKYDWMYQSTLQLGFRLFTLRSWKVLGGSSAINFMAYGRPSAVDLDDWG
TIAENSDWSWAGLAPYYRKSEHLESAGLTAPASDLCPVQEEAHGTQGPIHTTLGPWQAPI
ETPLLAAMNEIGEHLGFHRCLFTIDRSTGLPRRSYSAGYLWPVLSRSNLHVLNNAAATRI
ILDDKQCACGAEFVFDSNHYQVTVTREVILSAGTFESPKLLELSGIGEPEHLASLGVPCR
VPLPGVGTNLQEHPVSAVVYELADGVLSIEAILRDESLLKQHLQLLQEQHSGAFSGPVSL
MGTDSANALPRNLLDPRSADIQLVGFPSALAIYRVYADCSKFSPGPPPGRNACYSLMISS
MYPASRGSSHAQSRDPEAAQRVDLGFLTNPADLDVLATVVMVADNIFQSPRMKGQVLARV
QPPPEVNLQDVEQAREYRLCVKGTQGLRVVDASVMPAQVSHAVLGTVYAVAEKAVDLIES
THLHSNGCQ

Enzyme Prediction     

No EC number prediction in M747DRAFT_325151-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	16	496	1e-116	0.8697183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	6.71e-80	15	538	3	531	choline dehydrogenase; Validated
225186	BetA	4.12e-76	17	542	7	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	1.74e-29	74	315	1	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	7.06e-15	3	318	41	332	Protein HOTHEAD
398739	GMC_oxred_C	1.07e-13	423	534	1	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK97143.1|AA3_2	0.0	1	549	1	582
BCS02582.1|AA3_2	0.0	1	547	1	622
BCS14253.1|AA3_2	0.0	1	547	1	622
UPX44764.1|AA3_2	4.07e-161	7	542	3	612
ALI92648.1|AA3_2	1.90e-156	12	539	8	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	7.61e-55	15	539	3	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.30e-46	18	540	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
6ZE2_A	3.78e-46	16	542	4	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3FIM_B	6.52e-46	18	540	3	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
2JBV_A	1.26e-45	11	540	7	528	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A142PTM2|CITC_MONPU	3.38e-157	12	539	8	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	3.38e-157	12	539	8	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	8.88e-146	11	542	7	620	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	6.63e-70	3	539	25	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	1.91e-60	7	538	36	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998508	0.001498

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_325151-t43_1-p1.