CAZyme Information: M747DRAFT_320831-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_320831-t43_1-p1
• CAZy Family: GH43
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530	KZ851901|CGC8	57863.32	5.8325

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851901:1281388-1283387(+)

Full Sequence      

MHIEETFDFIIVGAGVAGCVLASRISQSRPDLRILLIEAGIEKDDRTSAAMGFVAGFDSD
LEWNLRSVPQERAFGGDTVCLASGKIVGGGSGVNYQVYTRGPAVDYDQWADLTWYPSVEM
KKRGLLTIDSHGDRGPIKVSHATNSGKPRNYPLREKSRRFHEFLGRKQADDMNSGQQLGY
SEAFSSSYAGLRSFASSYPLGSNVTLWTKATVERLIMAGRTAEGVAVARAVGDQIERVQV
RARKEVILSAGAYGSPKILLLSGIGPAAELKRHNITPVADLPVGKNYADHPHIFTYWTID
ECNATLGDGEMETDQVHWLAGLPYDWMSFAPADTKTQEIAKKILSPTERSRYLADGKMQL
ENFIVYAKPLEGWPGKRVISLMHVLVDSVSRGTLTLRSSDPADAPVLDPKLLASPVDRSA
LYENVRETARAIQAVEGLNAVEFGVDDSLRDNWSNEAIEVRANRSGGSTYHYSGTCAMGE
VVDTECRVYQAERLRVVDSGIIPLPLAAHYQAPTYGVAEQAADMILSSVA

Enzyme Prediction     

No EC number prediction in M747DRAFT_320831-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	527	1e-118	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.34e-77	3	527	4	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.45e-75	4	526	3	532	choline dehydrogenase; Validated
274888	Rv0697	6.56e-48	8	526	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	7.51e-30	390	521	3	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.23e-26	75	291	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10581.1|AA3_2	0.0	1	530	1	552
CAK47171.1|AA3_2	7.55e-292	51	530	1	428
BCR98132.1|AA3_2	2.59e-150	1	262	1	281
BCR98133.1|AA3_2	6.59e-138	311	530	1	228
QKX63105.1|AA3_2	6.60e-129	7	528	429	974

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	4.00e-44	7	525	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.05e-44	7	525	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	1.29e-41	6	525	5	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
3Q9T_A	1.20e-37	7	525	7	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	1.63e-37	7	525	7	569	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	1.75e-62	4	527	2	520	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|Q47944|SDH_GLUOY	4.16e-48	7	525	5	527	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q988C9|4PADH_RHILO	3.03e-44	5	528	5	536	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|P18172|DHGL_DROPS	3.51e-44	4	525	62	604	Glucose dehydrogenase [FAD, quinone] OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=Gld PE=3 SV=4
sp|A9M9H8|BETA_BRUC2	6.28e-44	8	526	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) OX=483179 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.992343	0.007683

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_320831-t43_1-p1.