CAZyme Information: M747DRAFT_314753-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_314753-t43_1-p1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1015		108820.72	4.0220

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851913:16586-19763(+)

Full Sequence      

MTRLSPLLVYLVSICATLSHAEDEYFTVGDLSQYTTNGIATPALTGSVIEVTAVGDPAEN
GILAFLSPDMQTSLKASMDSDCGAEIDSTCYQGVLDILDDPDRVLQSGSLQKRFNPVFLA
AGAIAVIAFLIAKVYQEDKVVPVPIKMPPEQLEDSFDLETATAIVFVTEDNNSGQTITQA
PEQDRATGSPATFTTFASAGNGASTGDMGIELDSKTAEHIQALLSGSDNSNCDVGADFFP
SSLRARSLDMDIICGAQNILADGIGRDGYPNWLLMNQRRFPWTNAEVVAGLNTMVGWALT
QARRLNPTISSSHLHDLAVGAFVLSWIYSNNGAITTNNIIPSASLQGGPTATVCQAQTAT
QCNVGCDVQPVAPQFACSTACVTVTSCDAQNTITTTATATMTAIGPDPTDDLDGQGQQVA
VASYINPLSDPAAWDRLIDYDAKKMPILVANVVNGPDSTVDSNWEDVIKRASSAGKTVLG
YVRTGYLGVSDQKFHTRLGSGDLADWTAQIEEDVDMWYKLYGDSIGGIFFDEGWPECGDN
NQYVDLYKYINAYTKRAHPGALTVLNPGSPMASCFEDTMDTLLTFELSYDSYVNSYTPND
WTPKDPRKLWHIVYDVPESAVSEVAKLANQRGAGFLQLTDDTLPNPYDTLPADSYIQSMM
DAIDGGSPLNADAASWETGSAAGAVSGLTVVTSDYSSAKLSWNAASDALGYYVYSGDSLI
ASVPSSMTTVTIGGLDSGTSYALHVSAVGGSGNLGSSSNTVAVETTSLPDGKTVTNSYAS
TSEGSTTIHADILVPYSFVRLYIWDSVGCEFDTDPGWTINFKIDNYVCAQYMVEGTTLYK
YSGTVPEGSTAPPWSWTVVGPITLTTTDYTYTWTLPIGTSTIDTSKFVVQAQGYNPLTNI
FEPVPDDYDCKGSSMCSTPGMLKWCDHAVNTLYRDDDPTYHSADDQNSLSGNCWGDQNRG
CGVFLQGQNCSISGNDMWNDYQNIRKIGGCKKCGSYHRGDGCLVTINYVYQCDNH

Enzyme Prediction     

No EC number prediction in M747DRAFT_314753-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH135	420	651	4.4e-21	0.9535864978902954

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403383	Spherulin4	5.26e-51	424	663	1	238	Spherulation-specific family 4. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 250 and 398 amino acids in length. There is a conserved NPG sequence motif and there are two completely conserved G residues that may be functionally important. Starvation will often induce spherulation - the production of spores - and this process may involve DNA-methylation. Changes in the methylation of spherulin4 are associated with the formation of spherules, but these changes are probably transient. Methylation of the gene accompanies its transcriptional activation, and spherulin4 mRNA is only detectable in late spherulating cultures and mature spherules. It is a spherulation-specific protein.
406036	MU117	5.57e-28	909	1012	1	104	Meiotically up-regulated gene family. This protein was identified as being up-regulated during meiosis in S.pombe. This family of proteins is found in largely in plants and fungi. Proteins in this family are typically between 128 and 920 amino acids in length.
238020	FN3	2.47e-05	683	748	2	77	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
214495	FN3	3.63e-05	683	748	2	77	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
394996	fn3	0.006	683	748	1	76	Fibronectin type III domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS11365.1|GH0	1.99e-222	407	1014	479	1109
BCR99052.1|GH0	1.99e-222	407	1014	479	1109
UNO38501.1|CE3|GH0	2.27e-132	413	908	493	990
SBO94845.1|GH0	1.74e-61	417	888	19	573
UBU17109.1|GH135	2.21e-61	417	888	34	588

PDB Hits     

M747DRAFT_314753-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	4.40e-07	697	788	480	576	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000247	0.999724	CS pos: 21-22. Pr: 0.9791

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_314753-t43_1-p1.