CAZyme Information: M747DRAFT_313795-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_313795-t43_1-p1
• CAZy Family: GH31
• CAZyme Description: pectin lyase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	KZ851908|CGC8	49454.57	6.3279

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851908:236010-237554(+)

Full Sequence      

MTLLRHLLTATALLGASVQAAQGVTGSPFGFASGTTGGGDATPAAPSDISQLKTWLSDST
PRVILIDKEFNFLGSEGKCTNCECCKPASNTCGSSGQNAVKQNGSDWCGSYPTLTCTYDN
AGIEGLEVASNKSIVGVGSSGVLRGKGLRLVNGVSNIIIQNIHITELNPEFIWGGDAITL
DGTNNVWIDHVKINLIGRQMFVAGYEASHSVTISNSEFDGETSWSATCDGHHYWTVLGYG
HNDKITFANNYIHHTSGRSPKLEFNSFWHAYNNYWYNNTGHAFDVGKNTRALIEGNVMVQ
VDTPLLADSNPGAVFAVNTSDVSTCTSTLGRTCVPNTLISSGTLSGSDSSVISSWPSGES
DVTVMAASKVASYVKANAGIGKLGNGSGSSSTVGAAATSAVAKRADSDDAPFVPAYSEAG
PGASAVPTQPSWSWRTVTNGPAPTGAPSDSPSAPQGLGAPVQASNKHHHQGHGRGY

Enzyme Prediction     

EC	4.2.2.10:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	115	298	2.1e-89	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.17e-50	117	297	5	185	Amb_all domain.
226384	PelB	8.21e-23	7	383	10	344	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.22e-20	128	297	32	210	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK48551.1|PL1_4|4.2.2.10	0.0	1	476	1	476
CAD34589.1|PL1_4|4.2.2.10	0.0	1	476	1	476
BCS01807.1|PL1_4	0.0	1	476	1	475
BCS13507.1|PL1_4	0.0	1	476	1	475
AIX03726.1|PL1_4|4.2.2.10	0.0	1	476	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	3.39e-101	23	383	2	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	2.70e-100	23	383	2	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	1.09e-93	23	382	2	359	Pectin Lyase B [Aspergillus niger]
1PCL_A	2.78e-12	126	311	76	289	Chain A, PECTATE LYASE E [Dickeya chrysanthemi]
3VMV_A	3.18e-10	131	296	80	244	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2R6A1|PELF_ASPNC	0.0	1	476	1	476	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	0.0	1	476	1	476	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|B8N316|PELF_ASPFN	2.08e-205	1	398	1	397	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	2.95e-205	1	386	1	385	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|Q0CZD4|PELF2_ASPTN	4.31e-191	1	427	1	431	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000428	0.999559	CS pos: 20-21. Pr: 0.9800

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_313795-t43_1-p1.