CAZyme Information: M747DRAFT_299292-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_299292-t43_1-p1
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	KZ851946|CGC1	42874.67	6.3607

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851946:229806-231120(+)

Full Sequence      

MFLFTSQKRFGRLILYALGVLGIILILWQLPYARPTVRIGARRARSQFEAIRNETLGVQK
IFAINLPSRVDKRDNLVLGSSVSGFNIDWVNGITPDEVDPRTYPYNWNYDHKPTEYGARR
AHVNAMQRIVHERIGSAMIMEDDVDWDVNLKTQLQSFALGVRALQGADKKVTASPYGDDW
DIIWLGHCGMECRTNEPYFVSSNDTTVLPPHHFLPYWRDPPPFGIPDYTRLTCAVNDAVC
SIVYAVSYHGAQKILSALSVNPTGLADKIDIGAQFDVSLGRMCGNGYLRCFAVYPSLTGG
YHPAGPSSKESDIHGGNEDVHPVSSHGVMYSTMLNINRILNGEDTVVSNWDDAPAPVINP
ANVSVVGGTMHMLQENDMYTLSVVNP

Enzyme Prediction     

No EC number prediction in M747DRAFT_299292-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	59	258	1.5e-22	0.9281767955801105

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	1.88e-19	60	149	1	98	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK40570.1|GT25	3.33e-284	1	386	1	386
BCS04381.1|GT25	4.28e-271	1	386	1	386
BCS15969.1|GT25	4.28e-271	1	386	1	386
BCS25421.1|GT25	5.77e-173	5	372	5	382
CAP99059.1|GT25	5.77e-155	5	372	5	380

PDB Hits     

M747DRAFT_299292-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

M747DRAFT_299292-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999174	0.000860

TMHMM  Annotations     

Start	End
13	32