CAZyme Information: M747DRAFT_298712-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_298712-t43_1-p1
• CAZy Family: GH27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	KZ851938|CGC2	44298.08	4.7350

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851938:267843-269024(-)

Full Sequence      

MPAMSGVCLPRQVRRVVPLFLAVFCLVFYLSLTGTFAEFHGGLARQSKCRLFPRKIWQSW
KVNPFEFEERDLNVARTWTSINPGYRYEVLTDQNDLHYVETNFGPDGLNRPDIVETYRSL
TAKIIKADLLRYLVMYVDGGVYADIDVEALRPLERFIPERFNEADMDLIIGVEIDEPDFN
DHAILGPKSQSFCQWTFISKPRQPVMMRLVDRILEWLHDHSVKQGKPISDLELDFDDIIS
GTGPSAFTEAVLAEMSARTGQEVTWKTFHDIPESKLVGGILVLTVEAFAAGQGHSDSGNH
NARSALVKHHYHASGWPNTHPRFKHPLYGEVEQCNWNKQCVADWDANTAAFAALSPEEQE
QQIAMKQAADAAETEMAVEDLAGDDGDLGLAIE

Enzyme Prediction     

No EC number prediction in M747DRAFT_298712-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	73	158	5.5e-20	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.27e-23	52	217	82	247	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.72e-14	69	159	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK96510.1|GT32	1.20e-291	5	393	20	408
BCS17076.1|GT32	1.39e-287	4	393	25	414
BCS05523.1|GT32	6.09e-286	4	393	126	515
QMW40889.1|GT32	8.74e-221	4	371	1	370
BAE58544.1|GT32	8.74e-221	4	371	1	370

PDB Hits     

M747DRAFT_298712-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	6.68e-36	53	316	143	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.84e-31	52	314	99	374	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	4.20e-31	52	288	130	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.69e-21	53	314	97	468	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	7.54e-09	53	157	58	153	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.297587	0.702395	CS pos: 37-38. Pr: 0.6731

TMHMM  Annotations     

Start	End
13	35