CAZyme Information: M747DRAFT_295450-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_295450-t43_1-p1
• CAZy Family: GH17
• CAZyme Description: GPI mannosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
414		45930.82	9.5739

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851913:288448-289840(-)

Full Sequence      

MASFFQTPSLVYTSAIALRAILLIYGAWQDANSAVKYTDIDYLVFTDAARYVSHGASPYE
RDTYRYTPLLAWLLLPTSWSGPSFLFSFGKALFALSDVLAGWLIARSLVSAYGMDAPRAL
KYASFWLLNPMVANISTRGSSEGLLGVLVIALLWAVLRRRVVLAGVLLGLSVHFKIYPFI
YGVSILWWLDRERDGSSSSTSKNNAGDASIITKMINFITPSRIILTLSSLITFSLLNLLM
YHLYDTPFLQHTFLHHLTRIDHRHNFSPYSTLLYLSAAGEVQGNFESLAFIPQLLLSVVV
IPLVLAKKSLPGAMLAQTFAFVTFNKVCTSQYFLWYLIFLPFYLPRSSMLKAPRFGGAVA
AAWVVGQALWLQQGYNLEFLGLSSFVPGLFLASLGFFAVNVWILGIIVGDVGAC

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	135	407	1.2e-98	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	5.47e-86	8	408	9	415	GPI mannosyltransferase
252941	Mannosyl_trans	3.06e-74	135	408	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	8.94e-06	47	201	39	202	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS05340.1|GT50	2.74e-272	2	413	9	421
BCS16894.1|GT50	2.74e-272	2	413	9	421
CAK48470.1|GT50	1.65e-258	1	379	1	393
UDD65877.1|GT50	7.28e-229	1	411	1	410
BAE66105.1|GT50	1.82e-228	1	411	26	435

PDB Hits     

M747DRAFT_295450-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB8|GPI14_ASPOR	1.29e-229	1	411	1	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q4WAH2|GPI14_ASPFU	5.61e-217	1	412	1	422	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q5B7W0|GPI14_EMENI	2.77e-212	1	412	1	429	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	2.16e-169	1	412	19	486	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	9.61e-160	1	410	4	407	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.923846	0.076170

TMHMM  Annotations     

Start	End
10	28
69	88
135	157
164	186
222	244
284	306
321	343
355	372
387	409