CAZyme Information: M747DRAFT_294513-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_294513-t43_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	KZ851909|CGC1	41147.13	5.1444

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851909:6085-7197(-)

Full Sequence      

MLPSTLKSSRYGRFVILTIPLLVFSCLLFLTWDPLPGRLARQQSTSQSDPLSQVPQAVEP
PKEEPSQPKTPVSTSKPSSSKPTADIAGGDAIFGITDKLWQSAKDPHLSDDQDEWISSWL
EKNPSFRYELLTDTSAATFVRTHYASRPDIIEVFETLPIPILRADLLRYLLVLAEGGVWS
DLDVTCDKPVADWVPTEYKNAKIEMIVGLEFDFEWRGEGTEIASQFCNWVFAAPRSSRVL
QVVVDAVVDKLKEIAAMNNVQVKDLTLEMLPIDVVNVTGPKIMTMAILDSLKQLLGRTVD
DRDFHGIKKPKLIGDVLIMPGVAFAASQNGYPQDQGDALVTHHYAGSWKQADAEAKEKKK
QKQNGRDKVV

Enzyme Prediction     

No EC number prediction in M747DRAFT_294513-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	114	196	5.8e-20	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.73e-17	95	212	82	198	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.15e-14	116	198	8	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK46331.1|GT32	1.04e-264	1	370	52	421
BCS14453.1|GT32	1.51e-243	1	370	1	373
BCS02801.1|GT32	5.36e-243	1	370	35	407
QKX62870.1|GT32	1.06e-126	1	363	1	378
QQK48128.1|GT32	6.31e-126	77	362	68	353

PDB Hits     

M747DRAFT_294513-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	3.23e-28	99	349	146	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	3.11e-22	114	349	122	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	3.49e-22	99	324	134	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	6.65e-14	90	241	91	276	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	8.85e-07	91	188	56	147	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000001

TMHMM  Annotations     

Start	End
13	32