CAZyme Information: M747DRAFT_291594-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_291594-t43_1-p1
• CAZy Family: GH135
• CAZyme Description: neuraminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		41571.48	6.4059

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851899:1053583-1054716(+)

Full Sequence      

MPGHFGQKILNTLGIDHHGHHGHGQGQPYQQPPPPGDNRLAGNRVIHNDERLLSPHPAGT
YPRLARLHDGRILASFTRFVGDGERVLMVSISEDNGQTFVDHGEITRGKGDVDNVYLLEI
GPGTVLAAFRNHDIGPGGPTHFRITVCRSTDAGRSWSFASQAAEKPAPFGIWEPFMRLGR
RPGEIQLTYSQEFAHNNQCTMLVRSYDGGSSWSAPHCLHGAEDQRRDGMNGIARTWDQAR
NCEALVMVFETTTYGTFDVEALVSYDDGETWGGRQQVYVPPQGHNAGAPQIASLGDGSLA
VIFMCDEDFGEVNWTRNACVKVVFGSMPHEGRIMWTRPTTVCADSSHWPGIFTLDDRRLL
ALYECGGPKAKTIALEW

Enzyme Prediction     

No EC number prediction in M747DRAFT_291594-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	58	320	1.1e-66	0.9022801302931596

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	2.82e-10	69	310	87	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	9.37e-09	62	370	17	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99274.1|GH93	1.12e-291	1	377	1	377
BCS11580.1|GH93	1.12e-291	1	377	1	377
QMW42642.1|GH93	3.22e-181	1	375	1	378
QMW30589.1|GH93	3.22e-181	1	375	1	378
QRD89469.1|GH93	3.22e-181	1	375	1	378

PDB Hits     

M747DRAFT_291594-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

M747DRAFT_291594-t43_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000011

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_291594-t43_1-p1.