CAZyme Information: M747DRAFT_289451-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_289451-t43_1-p1
• CAZy Family: GH13
• CAZyme Description: oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
579	KZ851955|CGC1	64117.30	5.3743

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851955:69414-71499(-)

Full Sequence      

MTVPVEDNFDFVVVGGGTAGNVVAGRLAENPDVRVLVIEAGVSNPGEISEITTPSSAFGL
RDSQYDWAYKSTMINKPYYERVEKPNTRGKVLGGSSSLNYYTWIRGSKGTFDAWAEYGGP
SWNWDGCEEYFNKPATYHDDDNLYPSELSRIGRNGPLHVSHADLVPELHTFRDALTEAWT
SKGQKTCEDIYSGKMEGLTHCVNSIYGGVRSTSASYLTDKPNVTILSSAIGKKVNFDGVK
ATSVTVIGADRTELTFTAKYEIILACGVFETPKLLMLSGIGAKDELARHGIDSVVDSEHV
GQNLHDHPILAHVFRLKDGTGLDGHLLRAGPAQSAALQKYRTSKKGPFSSGLLEMVGLPR
IDDRLERYKEYREAKAQNDGRDPFGPEGQPHFEIDFVPMFSDAFQWHFPVPPEGDWLTVI
VDLLRPLSRNGEVKLNSADPHQQPYINLNFFSNELDILALREGVRFVDDILMTGDGMKEI
LGEDYPWPMPRHSDEAMNKMILERSQTGYHPCGTARLSKDIAQGVVDPELRVHGVQNLRV
VDASIIPLIPDCRIQNAVYMIGEKGADMIKAAYPALYRS

Enzyme Prediction     

No EC number prediction in M747DRAFT_289451-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	571	4.7e-155	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.97e-108	9	570	6	532	choline dehydrogenase; Validated
225186	BetA	2.63e-102	2	578	1	542	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.48e-44	426	564	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.89e-28	9	562	56	569	Protein HOTHEAD
366272	GMC_oxred_N	1.29e-25	88	309	23	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02092.1|AA3_2	0.0	1	579	1	580
BCS13779.1|AA3_2	0.0	1	579	1	580
CAK97252.1|AA3_2	0.0	1	579	1	545
ATZ50069.1|AA3_2	9.20e-301	1	578	1	578
AEO67525.1|AA3_2	3.81e-298	2	577	4	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	2.75e-260	8	577	6	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	7.86e-260	8	577	6	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	2.24e-259	8	577	6	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	4.84e-76	8	571	1	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	2.65e-75	8	571	2	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	5.92e-74	4	572	2	536	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|B7N8L3|BETA_ECOLU	3.96e-65	9	570	3	532	Oxygen-dependent choline dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) OX=585056 GN=betA PE=3 SV=1
sp|Q0T7N0|BETA_SHIF8	1.09e-63	9	579	3	540	Oxygen-dependent choline dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) OX=373384 GN=betA PE=3 SV=1
sp|B1XE52|BETA_ECODH	1.52e-63	9	570	3	532	Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain K12 / DH10B) OX=316385 GN=betA PE=3 SV=1
sp|B1J0W6|BETA_ECOLC	1.52e-63	9	570	3	532	Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks) OX=481805 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000015

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_289451-t43_1-p1.