CAZyme Information: M747DRAFT_289030-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_289030-t43_1-p1
• CAZy Family: GH13
• CAZyme Description: FAD-binding domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524		55641.68	4.8036

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851952:45282-47041(+)

Full Sequence      

MVNLAYILGAVAVFSTSGTAADVSLSSSVAASTTPSAAGSLSSLGLSLPAGNVLVGNVGY
TCNLLSRTFPKNETFTASSPYYEALIDETWSGNSRLNASCIVTPRSAQEVSLVIQILSIL
ETKFSIRSGGHSSNPGFSSIGSNGVLVALGRLNTLSISADRKTLTVGPGNRWEAVYQYLE
QYNLTVLGGREPVVGVGGFVLGGGLSLFYNTNGLAIDTVTRFQVVTPNGTIVNATQTEHA
DLYKGLKGGLNNFGIVVEYDLTTNTGIDVWFEVKNYTLAETPALLAAYAAYLQNADIRSN
VEIQTNPAYTLVFYGYLDHVSAPSAFNAFSQVPSVSTVYPPTNASLNQVLLDIGNAGVVG
SLYTYSISFAFKVTSPSFLQESFKAYLKTAASLLPLGVILEYVPQGIIPNLVTKSQTQNG
GNLFGLEATPQVWGEIFAQFPATVSQSTVANAVESLLANLTSSAQSQSVHLPYIFANDAG
PNQQVLRGYGEDNVKYIAAVAERYDPRGVMQKLQNDAYFVSKEL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	90	334	1.4e-48	0.5327510917030568

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	1.22e-17	98	235	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	5.86e-16	98	261	32	201	FAD/FMN-containing dehydrogenase [Energy production and conversion].
223882	MurB	0.003	97	185	20	106	UDP-N-acetylenolpyruvoylglucosamine reductase [Cell wall/membrane/envelope biogenesis].
215242	PLN02441	0.009	216	256	191	231	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHG26149.1|AA7	1.52e-16	80	349	24	295
ADI58761.1|AA7|1.1.3.-	7.81e-16	99	263	38	202
CEI70304.1|AA7	1.98e-15	53	263	9	226
RDX44700.1|AA7|1.1.3.-	2.81e-15	99	307	70	284
AAS79317.1|AA7|1.1.3.-	3.60e-15	99	263	63	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HSU_A	5.36e-17	99	263	44	208	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
6FYD_A	8.11e-17	61	295	10	240	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYE_A	1.08e-16	61	295	10	240	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]
1ZR6_A	1.26e-16	99	263	44	208	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
6FYF_A	1.44e-16	61	295	10	240	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G3Y424|YANF_ASPNA	0.0	1	524	71	580	FAD-dependent monooxygenase yanF OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) OX=380704 GN=yanF PE=1 SV=1
sp|A0A2P1DP98|MACF_PENTR	1.18e-246	1	524	1	519	FAD-dependent monooxygenase macF OS=Penicillium terrestre OX=374132 GN=macF PE=3 SV=1
sp|A0A0U5GQ05|DRTC_ASPCI	2.49e-56	58	522	41	515	FAD-dependent monooxygenase drtC OS=Aspergillus calidoustus OX=454130 GN=drtC PE=1 SV=1
sp|D7UQ40|SOL5_ALTSO	7.60e-49	56	513	53	507	Bifunctional solanapyrone synthase OS=Alternaria solani OX=48100 GN=sol5 PE=1 SV=1
sp|B6H064|PRX3_PENRW	2.29e-44	62	513	32	500	FAD-dependent monooxygenase prx3 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=prx3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000433	0.999545	CS pos: 21-22. Pr: 0.6278

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_289030-t43_1-p1.