CAZyme Information: M747DRAFT_286919-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_286919-t43_1-p1
• CAZy Family: GH12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447		48235.45	4.3530

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851939:265313-266871(+)

Full Sequence      

MSTMLTRPTAILIFSLVFLNLYLFHRLIRQPVVPLSPTIVPTPSPAAAEIQETHLPAQIT
TTTEDPTTLFPTTTLATITTHTTTTTTTTTHPHNTHIHPQPTTHSIPHKLWQKTGSKGLS
PQAESWISTWTALNPHLRHEVLTDSSGLAYVETNFRPIWPEIADLYTSLSVPILRADLLR
LLILYIDGGIWSDLDVSCEVPISQWPIPPAANVVVGIEFDGWQFASWTVLSTPGNNHIYH
AIEYVAGRLEALAQENNVTVGEVTMEMIPDVVDVTGPQAITMAFLETISESVGRRVGKDE
VEGLGEGGVLLGDVLVLPQASFAALQGGMPTGQGEYLVSHHYAGSWKNEVGGEEGVKEEE
EEDGDEEVVIVVEGEDGDGDGNGGEGEGIRVCYAMLCILTFTGNCSSSHVALLTVNCFCS
VSSNSTAHSAAIANVAPELLSMMRQSP

Enzyme Prediction     

No EC number prediction in M747DRAFT_286919-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	124	206	9.9e-17	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.80e-15	106	234	82	232	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.56e-11	124	207	9	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK40793.1|GT32	4.71e-273	4	447	1	444
EAA62114.1|GT32	2.68e-91	10	355	14	366
BCS30122.1|GT32	1.17e-90	10	355	14	365
QQK40626.1|GT32	2.84e-84	98	353	85	341
CAP80736.1|GT32	5.60e-81	98	353	88	341

PDB Hits     

M747DRAFT_286919-t43_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	4.26e-17	106	349	142	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.98e-11	99	349	92	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.99e-10	99	262	89	299	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	2.07e-10	106	348	130	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_286919-t43_1-p1.