CAZyme Information: M747DRAFT_279437-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_279437-t43_1-p1
• CAZy Family: GH10
• CAZyme Description: putative beta-mannosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
844		97116.78	5.7011

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851913:295894-298643(+)

Full Sequence      

MAAFAQYTLSTGWYFKDRDELASEAWMPVPVVPSVVHQDLQANGKLKNPYVGFNELDARW
VNEKSWTYRKILQKPTVLAGSRIVLAFDGLDTFAKVKLDNNIILESSNMFQAYRVDVTKA
LDCGDEHVLEIEFDCAMLRAQELRKQDPNHNWASFNGDPARMSVRKAQYHWGWDWGPVLM
TAGIWRAVRLEVYSTRLADLWTEINLDPTHKTASISAFTELESVDLDPSYKVKFTITLHG
KQIAQAEATPQEGRAKVEFNIDQPCLWWPHGYGDSTLYEVSASLNADQLELHRVTKKIGI
RTAEVVQRPDKHGKSFFFRINGVDIFCGGSCWIPADNLLPNISPQRYRKWIQLMVAGRQA
MIRVWGGGCYEDDSFYEACDELGVLVWQDFMFGCGNYPTWPELLKSIEQEAIYNVRRLRH
HPSIVVYVGNNEDYQVQEQAGLEYNYEDKNPENWLKTNFPARYIYEELLPSVVERCSPKT
FYHPGSPWGDGKITSDPTVGDMHQWNVWHGTQEKYQIFDTLGGRFNSEFGMEAFPHLSTI
EYFVENEKDKYPQSHVLDFHNKADGHERRIATYLVENLRTATDLETYIYLTQVVQAETMM
FGYRGWRRQWGDERHCGGALLWQLNDCWPTISWAIVDYFLRPKPAYYAVARVLNPVAVGV
RREHHDWSITHAQPPKTSKYELWVVSSLQKPASGKVELRFLSVDTGREIRERIVRENVDI
VPNGTTNLITDGLIDHTVDAEPHVLAARLWVDGEIVARDVDWPQPFKYLDFADRGLEVKR
VSEASDQQVFQISTEKPVKCLVFEERDGVKFSDSAMDIVPGDVQTVKVTGLRADEKLKYK
FLGQ

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	8	670	1.1e-92	0.625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.00e-80	8	658	14	634	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	4.29e-18	678	768	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	4.01e-10	195	301	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
236657	PRK10150	6.42e-09	68	322	69	289	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK48467.1|GH2	0.0	1	844	1	844
CAV33671.1|GH2	0.0	1	844	1	844
BCS16892.1|GH2	0.0	1	844	2	844
BCS05337.1|GH2	0.0	1	844	2	844
UDD65874.1|GH2	0.0	1	844	1	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	5.75e-147	1	785	21	770	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	4.72e-130	9	832	11	820	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	4.96e-130	9	832	13	822	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	5.09e-130	9	832	13	822	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.33e-129	9	832	11	820	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QYN2|MANBB_ASPNC	0.0	1	844	1	844	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
sp|B0YBU9|MANBB_ASPFC	0.0	1	844	1	845	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|A1CGA8|MANBB_ASPCL	0.0	1	844	1	845	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|B8NW36|MANBB_ASPFN	0.0	1	844	1	844	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
sp|A1D911|MANBB_NEOFI	0.0	1	844	1	845	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_279437-t43_1-p1.