CAZyme Information: M747DRAFT_276456-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_276456-t43_1-p1
• CAZy Family: CE8
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636		69646.09	4.8423

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851907:72457-74631(-)

Full Sequence      

MSNDQDMPRMPQRPVLPPNACSHQTCLGRISSLTAWILVLLAFATTTLGASGDYLDDAEQ
GVPGLDASFDYVVVGAGAGGLTLAARLAQHRYKVALVEAGDFYEFKYPLAAVPGAGIIGI
GSDVSSSTPVDWRFVAYAVPGANYRDLHYPRGKCLGGSPNKEAMQKWAELVNDDSYTFDR
VLPFFQRTANFTPPNNDVRNSNATASFNQGAFDKRGEPLQVSYPEFAVPFSSWVKRGMES
VGIPEIQDFNSGSLLGAQYCALTIDPHKKIRSSSEAAFKSSPIPRLMTLAVYKKTMAKRI
LFNIERRATGVEVRTGGSKYILRATREVIVSAGAFQSPQLLMVSGIGPANELKQHGIEII
VDLPGVGKNMWDHVFFGPAYRVALPTSTRIATDFLYLTEVIVQYLSNHSGPLSTQGIDFL
AFEKVPIELRSHFSEETIRDLSWFPPGWPEIEYIPVALYLGDFSDPIKHQPLDGAQYASI
AGALVAPTSRGNVTIISDDTDDLPIINPNWLATDTDQEVAIAIYRRNREIFHSAGMEPII
DGEEYFPGEELQTDSEILEVVKDTLMTVYHASCTCKMGVRNDSMAVVDSQARVFGVDGLR
VVDASAFPILPPGHPQSVVFLDMLAEKIASDIISWD

Enzyme Prediction     

No EC number prediction in M747DRAFT_276456-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	68	633	8.2e-161	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	7.63e-103	68	633	5	531	choline dehydrogenase; Validated
225186	BetA	1.19e-87	66	632	5	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.14e-38	487	628	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.43e-30	64	621	51	567	Protein HOTHEAD
366272	GMC_oxred_N	2.39e-16	150	373	22	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK42385.1|AA3_2	0.0	10	636	1	601
BCS13823.1|AA3_2	0.0	26	636	2	620
BCS02136.1|AA3_2	0.0	30	636	1	615
QRD89774.1|AA3_2	7.97e-251	37	635	18	627
QMW30869.1|AA3_2	7.97e-251	37	635	18	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FIM_B	1.56e-51	67	636	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3Q9T_A	6.75e-51	69	632	7	569	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	9.28e-51	69	632	7	569	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.28e-50	69	632	7	569	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.44e-50	69	636	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1U8QYA8|CICC_EMENI	4.77e-164	40	634	11	609	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	1.67e-160	61	632	44	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	5.32e-159	61	632	45	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	4.51e-153	66	629	38	604	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q0CJ60|ATC_ASPTN	1.25e-136	61	634	38	595	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.601699	0.398299

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_276456-t43_1-p1.