CAZyme Information: M747DRAFT_261564-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_261564-t43_1-p1
• CAZy Family: AA7
• CAZyme Description: UDP-Glycosyltransferase/glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	KZ851919|CGC4	50677.04	5.0920

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851919:250097-251525(+)

Full Sequence      

MTIDTKVTPSEDHCSKPLIVIACTTIIGHTLPLLPHATALTKQGFDVSFIGGQEFETLIR
KTGATFYPLKNLYSPESLDYVKTIPDRIARTVWGLKTYFVDVTASRMKSLQAVLETLREK
HPNREVILIQELGYMGTWPFLLGAPLPKGYERFPKTLTFSTSPLLVSSVDTAPFGHSLPP
DPSDDGRARNAAMYAAEKAIRDDLVDYTNSVYASLGATMKVDQWLFDLWSTGHNILLQPC
SPSLEYPRSDLSPKVRFIGGTPRREVDPSTPLPEWWGELEMNRQATNPKKVVFVTQGTIK
IHYKDLLIPTVQAFANRPDVMVIGVLGVKGAVLDDDFEIPDNAKITDYLSYDAVLPYVDV
FVTNGGYGSFMHGVMNGVPMVLAGTVQDKGEVCMRGEWAGIGINLRTDTPSPETIRKSVE
LILSDPEYKARSVVIQRENEELDCVGSVQRYILEDE

Enzyme Prediction     

No EC number prediction in M747DRAFT_261564-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	149	452	1.4e-31	0.680628272251309

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224732	YjiC	1.57e-38	28	454	13	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
340817	GT1_Gtf-like	1.67e-28	19	441	3	391	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
273616	MGT	9.34e-24	28	441	7	375	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	4.91e-08	244	429	237	412	UDP-glucoronosyl and UDP-glucosyl transferase.
223071	egt	0.002	252	431	264	438	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39187.1|GT1	0.0	1	456	1	456
BCS13313.1|GT1	3.84e-284	1	456	1	455
BCS01597.1|GT1	3.84e-284	1	456	1	455
UQC81531.1|GT1	2.66e-123	10	454	114	556
UPK94024.1|GT1	6.41e-123	16	453	25	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OTG_A	1.89e-11	28	438	32	389	Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP bound form [Micromonospora echinospora],3OTH_A Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora],3OTH_B Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora]
6J31_A	3.15e-11	283	438	222	376	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	3.19e-11	283	438	225	379	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6PNT_A	3.62e-11	288	448	269	424	Structural Characterization of UDP-glycosyltransferase from Tetranychus Urticae [Tetranychus urticae]
2YJN_A	2.47e-08	339	430	317	408	Structure of the glycosyltransferase EryCIII from the erythromycin biosynthetic pathway, in complex with its activating partner, EryCII [Saccharopolyspora erythraea NRRL 2338]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J4VV61|GT1_BEAB2	1.38e-103	28	453	30	455	UDP-glucosyltransferase 1 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=BBA_08686 PE=2 SV=1
sp|E9L011|UGTB1_STABO	5.89e-70	16	454	5	429	UDP-glucosyltransferase B1 OS=Starmerella bombicola OX=75736 GN=ugtB1 PE=1 SV=1
sp|E7CQW6|UGTA1_STABO	1.31e-69	16	454	7	433	UDP-glucosyltransferase A1 OS=Starmerella bombicola OX=75736 GN=ugtA1 PE=1 SV=1
sp|Q8KHE4|REBG_LENAE	2.39e-53	19	445	5	410	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
sp|O05496|YDHE_BACSU	4.84e-08	289	430	225	364	Uncharacterized UDP-glucosyltransferase YdhE OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000016

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_261564-t43_1-p1.