CAZyme Information: M747DRAFT_247921-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_247921-t43_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768	KZ851953|CGC1	85609.35	6.1472

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851953:104322-106677(-)

Full Sequence      

MPSTYLGALATLAVFPCLGQARSTWPLGSGLELSYQASQHQISIHQDNQTIFSTIPGQPF
LSASAGKDQFVEDSGNFNITNVNQARCRGQNITQLAGIPRSDSVKNQVAVRGYLLDCGGE
DIAYGMNFWVPRRFSDRVAFEASVDSEANASVPVDRLYLTFASHALEDFYGLGAQASFAS
MKNRSIPIFSREQGVGRGDQPYTAIEDSQGFFSGGDQYTTYTAIPQYVSSDGRVFYLDEN
DTAYAVFDFQRSDAVTVRYDSLSVHGHLMQADTMLDAITMLTEYTGRMPTLPEWVDHGAL
LGIQGGQEKVNRIVKQGFEHDCPVAGVWLQDWSGTHLQSAPYGNMNISRLWWNWESDTSL
YPTWAEFVQTLREQHGVRTLAYVNPFLANVSSKSDGYRRNLFLEASQHRYMVQNTTTNST
AIISSGKGIDAGILDLTNEDTRAWFADVLRTQVWSANISGCMWDFGEYTPITPDTSLANI
STSAFFYHNQYPRDWAAYQRSVAAEMPLFHEMVTFHRSASMGANRHMNLFWVGDQATLWT
RNDGIKSVVTIQGQMGISGYAHSHSDIGGYTTVFEPPTTSNSSGAIPRSAELLGRWGELG
AVSSAVFRSHEGNVPSVNAQFYSNSTTYAYFAYNARLFRSLGPYRRRILNTESQRRGWPL
LRMPVLYHPEDLRARQISYESFFLGRDLYVAPVLDEGHKSVEVYFPGHSANRTYTHVWTG
QTYRAGQTAKVSAPFGKPAVFLVDGASSPELDVFLDFVRKENGTVLYA

Enzyme Prediction     

No EC number prediction in M747DRAFT_247921-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	268	746	2e-68	0.9882903981264637

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236691	PRK10426	3.14e-178	26	751	4	626	alpha-glucosidase; Provisional
269880	GH31_glucosidase_YihQ	8.74e-150	286	635	1	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
224418	YicI	1.43e-61	157	767	143	689	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	9.65e-41	272	746	6	440	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	9.58e-34	353	707	49	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39259.1|GH31	0.0	1	768	1	768
BCS07610.1|GH31	0.0	1	768	1	768
BCR95040.1|GH31	0.0	1	768	1	768
QMW44330.1|GH31	0.0	3	766	5	768
QMW32300.1|GH31	0.0	3	766	5	768

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AED_A	2.23e-96	31	741	9	661	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
5AEE_A	1.19e-95	31	741	9	661	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
6PNR_A	1.61e-88	154	766	99	669	Chain A, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5OHY_A	4.27e-84	33	741	1	646	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5OHS_A	2.23e-83	33	741	1	646	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32138|SQASE_ECOLI	9.43e-96	31	741	9	661	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
sp|B3PEE6|OL4AG_CELJU	4.88e-16	141	706	126	633	Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=agd31B PE=1 SV=1
sp|Q69ZQ1|MYORG_MOUSE	1.55e-11	287	706	313	680	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
sp|B9F676|GLU2A_ORYSJ	2.76e-10	314	754	380	783	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
sp|Q6NSJ0|MYORG_HUMAN	1.49e-08	299	706	322	678	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000233	0.999745	CS pos: 21-22. Pr: 0.9799

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_247921-t43_1-p1.