CAZyme Information: M747DRAFT_234092-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_234092-t43_1-p1
• CAZy Family: AA3
• CAZyme Description: FAD/NAD(P)-binding domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1024		111740.18	6.5376

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851909:862981-868783(-)

Full Sequence      

MRVLGAVALGVALLSTTIAAASVKELGALLPTCAVKCMAVTIPKTSCTLADQTCQCTDET
YTALLQECVVSSCTTKESLTTKNVTSTACGAPVRDRTKAVSYAGVIGLVIACIAFILRIV
ARFKCLGGTFGMDDLTMGLTMCLVIPLSALSVVLADTGLGKDMWTLPFENVTRILYIYFW
DELLYLSILPMTKISICCFYLRIFPARNFRSLTYIVIGLNIAYLLAFVLVSIFQCRPIQG
AWLHWDGEGNYKCNHINAQGWASAIINMLLDLIVMILPLKQLYELQLSIKKKAFVMCMFS
LGIFVTVVSILRLDSLINFASTDNVTWDYVTVGYWSTIECHVGVICACLPAIRSLLRTTA
PKLFGDTSLNKSSGMNSTSRGTGSRLEGAFHTEYDYVVVGSGAGGGPVAARLAIAGHKVL
LLDAGDDQGNATVQQVPALQLQSTEYEPMRWDYFVHHYSDLTRQKEDSKMTYRTPAGDLH
VGFNPPGGSEPLGILYPRAGTLGGCTSHNAMITIYPYEHDWNHLASITGNDSWSADNMRQ
YFERLEKNRYLPSSVAGHGMDGWLMTSLTDLRLVIEDQKLLSLILAAATAAGKSLLEKVI
TTVTGLGEVLLRDLNNPSPTRDYETGPYQVPLAVELPEHRRTGPRDFILDTVNAVNSDGS
RKYHLDVQLNTLVSKVQFDTSAPEPKATGVEYLTGQSLYRADPRASRTSSPGTPGSVKAS
REVILAAGSFNTPQLLKLSGIGPQEELSKHGIKTLVNLPGVGSNLQDRYETGVIGQSPTD
FVLTEKCTFLYSSPDPCLEQWKNGTLFKGTYTTNGIAIAVIRKSSTADDTPDLLVSGAPV
KFPGYYPNYSYEGLKESNHWTWITLKAQSRNNAGTVELRSTNPRDTPVITFNYFDTGNTT
DGVDEKDLQAVHDAMEFSRTIFRDLVPLDGGFTEIWPGSNVTAGSKLKDFIKREAWGHHA
CCTAPIGDDSDPKAVLDSDFRVRGVKGLRVVDASVFPKIPGYYIALPIYIISEKAADVII
ADAA

Enzyme Prediction     

No EC number prediction in M747DRAFT_234092-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	393	1021	3.3e-94	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	6.45e-57	411	1014	25	528	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.62e-55	665	1014	216	526	choline dehydrogenase; Validated
398739	GMC_oxred_C	9.16e-32	874	1014	5	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.97e-21	665	1001	235	558	Protein HOTHEAD
399033	CFEM	1.74e-16	28	90	3	66	CFEM domain. This fungal specific cysteine rich domain is found in some proteins with proposed roles in fungal pathogenesis. The structure of the CFEM domain containing protein 'Surface antigen protein 2' from Candida albicans has been solved.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS05589.1|AA3	0.0	405	1024	49	668
BCS17142.1|AA3	0.0	405	1024	49	668
CAK41424.1|AA3	0.0	405	1024	49	628
QMW39616.1|AA3	0.0	392	1024	47	678
QMW27545.1|AA3	0.0	392	1024	47	678

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	1.53e-35	386	1019	6	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.53e-35	386	1019	6	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
6YS2_AAA	1.67e-35	393	1023	7	564	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	2.23e-35	393	1023	7	564	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	2.99e-35	393	1023	7	564	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6LGH5|BETA_PHOPR	1.67e-42	391	1022	2	533	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	6.51e-42	394	1020	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|A0A1U8QYA8|CICC_EMENI	7.34e-42	394	1023	36	611	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|A6X2G7|BETA_BRUA4	1.80e-41	393	1017	2	523	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1
sp|Q8BJ64|CHDH_MOUSE	1.96e-41	393	1019	42	573	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999732	CS pos: 19-20. Pr: 0.9728

TMHMM  Annotations     

Start	End
4	23
99	121
136	155
183	205
211	233
260	279
294	311
332	354