CAZyme Information: M747DRAFT_227736-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_227736-t43_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	KZ851899|CGC3	57448.19	5.9616

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851899:1390977-1392759(+)

Full Sequence      

MPSSLASVIALTFFIPFAVSVQFNKFNVTREISISPAANPRPGKQTVDAAYQSFSIEFSF
MSDYAGNDTHPNLFSRRVIQNLYDISGAYPIFRVGGSTQSSAIYYPNQTEAIIDPFSSVA
SDQPSHTFVGPSWFQSFRQFPNGTQYIYGLNFFNTVNETYNNIGNGLDQCVLEANAAYKT
MEKSLYAFEIGNEVDGWGNGKHREGNWTVQRYVNQWNEFATAISRNLTGKNAARLFQGCA
FEAPRHINERTDCWNIENAELDGMHPDKTKTVSDHEYMGANCHYTGAGPTIEDTLFDRTN
MLSRVWYHDYLGNATAESGIKYVIGETNSISCQGAFNISDVMASAVWAVDYVMYLSSLKV
SRVHFHMGTRYRYSPWQPIVYNDSAPHVNPMYYGNLFNAAVFAGGNKQTEVLVNETNFGA
YAVYKSGSLDAIVAVNLNIWNSTLDPVARPYTALALPEIWKDAKVSRLTSPGVDIAGNIT
FAGQYVNENASIVGQKIYDKVTGGKVLVGAGEAILVQR

Enzyme Prediction     

No EC number prediction in M747DRAFT_227736-t43_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH79	49	477	2.4e-84	0.9076923076923077

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407104	Glyco_hydro_79C	8.57e-18	420	515	1	103	Glycosyl hydrolase family 79 C-terminal beta domain. This domain is found at the C-terminus of glycosyl hydrolase family 79 proteins. It's function is not yet known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK41913.1|GH79	0.0	1	518	1	518
BCR99142.1|GH79	4.95e-315	61	518	1	457
BAE62550.1|GH79	8.98e-311	3	518	2	503
QMW44049.1|GH79	1.86e-310	3	518	2	513
QMW32021.1|GH79	1.86e-310	3	518	2	513

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DFQ_A	1.07e-21	22	516	1	457	Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum],7DFS_A Chain A, 4-O-alpha-L-rhamnosyl-beta-D-glucuronidase [Fusarium oxysporum]
5BWI_A	3.86e-13	36	436	20	365	Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei],5BWI_B Crystallographic structure of a bacterial heparanase [Burkholderia pseudomallei]
5G0M_A	7.49e-13	46	491	25	444	beta-glucuronidase with an activity-based probe (N-acyl cyclophellitol aziridine) bound [Acidobacterium capsulatum],5G0Q_A beta-glucuronidase with an activity-based probe (N-alkyl cyclophellitol aziridine) bound [Acidobacterium capsulatum]
3VNY_A	7.76e-13	46	491	25	444	Crystal structure of beta-glucuronidase from Acidobacterium capsulatum [Acidobacterium capsulatum ATCC 51196],3VNZ_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum in complex with D-glucuronic acid [Acidobacterium capsulatum ATCC 51196],3VO0_A Crystal structure of beta-glucuronidase from Acidobacterium capsulatum covalent-bonded with 2-deoxy-2-fluoro-D-glucuronic acid [Acidobacterium capsulatum ATCC 51196]
5L77_A	1.84e-12	46	491	45	464	A glycoside hydrolase mutant with an unreacted activity based probe bound [Acidobacterium capsulatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QEQ6|GUS79_ASPNC	5.99e-53	51	517	53	530	Beta-glucuronidase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=An02g11890 PE=1 SV=1
sp|Q7SFB0|GUS79_NEUCR	3.93e-49	31	443	21	442	Beta-glucuronidase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU00937 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000376	0.999572	CS pos: 20-21. Pr: 0.9773

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_227736-t43_1-p1.