CAZyme Information: M747DRAFT_145648-t43_1-p1

Basic Information

• Species: Aspergillus niger
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus niger
• CAZyme ID: M747DRAFT_145648-t43_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1215	KZ851954|CGC1	118478.48	4.1523

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AnigerATCC13496	12468	1353008	274	12194

• Gene Location: location=KZ851954:7319-11141(+)

Full Sequence      

MVFKPLTIAAAIAGLTPFVSAFDAQAKSNVAVYYGQGYGQQRLSHFCQETSLDIINIGFI
NTFPDQGAAGWPGSNFGNQCDGLTYEVDGVSTKLLSGCHQIAEDIPICQAAGKKVLLSLG
GASPDNQQILSDASAVRFADFLWGAFGPQTEEWVSNDGPRPFGEVVVDGFDFDIEHNGGF
GYATMVNRFRELFALVPERTFYISGAPQCPIPDPQLSDAIAQSPFDFVWVQFYNTAGCAA
SDSINGVSTGFNFDDWVDVIKRGANPDAKLYVGLPAGPGAAGAGYYLTPEEVYPLVDVYM
NLYPETFGGIMLWEATASDENTFSGLTFADVIKDILVAVDPSPPVPSPSSSSVIASSTPV
ASSTPVASSAPASSTPISSGSPVPSSSAVSSSPAVSSTTESSSTQVVSGSVSASSSPITS
SPVASSTPVASSAPSATSSAVASSSPIAPSSPVASSSAIASSSAIASSSAIASSSAIASS
SAIASSSAIASSSPVAPSSPVASSSPAVSSSAIVSSTPAVSTPVASSIPVISSPAIASGS
AIASSSHVASSSTPAASSSPAVSSSPVASSSPALSSSPSASASSTPIIPSSTASSAVVSS
SPTPSSSVVRSSSLLSSSSPALSSTRTPSNPVIPSSSAISITPSSTPVRSTSSVAPGKSS
SAPVIPKPSSTVIATFTSSSGSLPSSSAPAGSGVPSSSTLPHPSSTSLLSSSPVSSAEPV
SSSSAVGTSVGSSSNVVTGVSTRSSSSVVPSGTPIPPVSGTATESVTSSSSGSGSPTVPS
SINTSSTDASSSSSASSVEPTSSGSVITSVTSSSASRVSSSSSSVVITNPSVPSDSSSSS
GSELSTTSSTESTSSASSQTGAPTTSVSLGSSEAASTSTSGAAASGSGAQDSTKPTDHAS
TLSPSYSTPLASASGQTGSPTTVPAGIPTGNGSGLAPITSSITSAQAVPSVTSSGLESEP
EPTITTTVIVTSYIDICPEGFTTITTTYTTTYCPATVSATATATAAVTNPPGAPAQTTSP
SVPEGWTTTVTVCTHCAPTPTTVTLTLPATNRPSALASSTSAPNSPEDWTTTVSVCTDCG
PTPTTVTVTIPVGAATGVDALTASPSGSQPAGESSPGQSAPTAPASTAPTTTETVIVVPS
QSSTSQPVILGTGSVRASSTFHIQPSQSGSRVPVAPSGTAAGVSPVFTGAASRVSRLQHG
AGAVSAFALFLLAAI

Enzyme Prediction     

EC	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	28	280	2.4e-24	0.6655405405405406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	7.63e-111	28	334	1	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	6.19e-17	29	274	1	220	Glycosyl hydrolases family 18.
119349	GH18_chitinase-like	3.17e-08	30	234	1	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119350	GH18_chitinase_D-like	4.96e-05	100	324	61	306	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
119363	GH18_CTS3_chitinase	6.48e-04	104	314	64	252	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK40432.1|GH18	0.0	1	1215	1	1257
BCS11270.1|GH18	2.15e-282	1	1215	1	1271
BAE61604.1|GH18	1.20e-157	1	349	1	348
QRD90437.1|GH18	4.11e-156	1	349	1	348
QMW31454.1|GH18	4.11e-156	1	349	1	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4TX6_A	1.25e-147	27	337	1	309	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2XVN_A	3.34e-147	28	337	1	308	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
2XTK_A	3.46e-147	28	337	2	309	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
2UY2_A	1.62e-57	23	338	1	289	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2GSJ_A	9.23e-42	30	314	3	254	cDNA cloning and 1.75A crystal structure determination of PPL2, a novel chimerolectin from Parkia platycephala seeds exhibiting endochitinolytic activity [Parkia platycephala]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QUQ2|CHIA1_ASPNC	0.0	1	1215	1	1257	Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=ctcA PE=2 SV=1
sp|Q873Y0|CHIA1_ASPFM	1.82e-152	8	357	9	353	Endochitinase A1 OS=Neosartorya fumigata OX=746128 GN=chiA1 PE=1 SV=1
sp|Q4WEP7|CHIA1_ASPFU	2.88e-151	8	357	9	353	Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiA1 PE=3 SV=1
sp|Q92223|CHIA1_EMEND	8.61e-131	4	349	4	349	Endochitinase A OS=Emericella nidulans OX=162425 GN=chiA PE=2 SV=3
sp|G5EB30|CHIA1_EMENI	8.61e-131	4	349	4	349	Endochitinase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999770	CS pos: 21-22. Pr: 0.9756

TMHMM  Annotations     

There is no transmembrane helices in M747DRAFT_145648-t43_1-p1.