CAZyme Information: KZZ98201.1

Basic Information

• Species: Ascosphaera apis
• Lineage: Ascomycota; Eurotiomycetes; ; Ascosphaeraceae; Ascosphaera; Ascosphaera apis
• CAZyme ID: KZZ98201.1
• CAZy Family: GT71
• CAZyme Description: Alpha-L-fucosidase [Source:UniProtKB/TrEMBL;Acc:A0A168DWU6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493		55155.34	5.3101

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AapisARSEF7405	6442	392613	0	6442

• Gene Location: location=AZGZ01000001:1381764-1383360(+)

Full Sequence      

MVLPTKILIGAGMLNAATAAVIPSLKSSRASTIKPKYRISPLDGSKIALPSKPQLDFQDK
EIGVLIHYNIATYIDEDGCNFVPRLVPNVDLFDPQLIDTDQWMESIKALGGKYATLVAKH
NCGFNLWPSQVTFENRDNQTVPYNYTIADSPKHGMDLVRNFVESTEKYGVGHGFYYSVVV
NNFLKVAQSSVLNDSLAPGQVAITNTTYDQIVLDQLTELWSDYGSLTEIWFDGGYSATQK
DKIQDLLARLQPEAAIFNGCDEVGTCLTQNPIRWIGTEEGHAPEETWSTGLKNDGGDPES
EWFAPAECDTTLQNKDRWFFGMNATIRSFKEMVDVYHKTVGHNCVLELDLTPDRSGLVPA
EYAARYKQLGDFIRSCYGQPATDAMWTQTDQNGDYHMHFTKPTPVDRIQLMEDQTNGQVI
RAYEVLGKVVDANHANGTMNVPWTTLSKGTSIGHKKIDLFKKPVTVTEIVVKATKFVDTP
RWRTISVHLCDRY

Enzyme Prediction     

No EC number prediction in KZZ98201.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	51	374	1.7e-48	0.8641618497109826

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226195	AfuC	4.29e-30	48	487	9	429	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
395889	Alpha_L_fucos	5.19e-20	90	374	77	329	Alpha-L-fucosidase.
214829	Alpha_L_fucos	3.52e-17	57	374	23	331	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI23119.1|GH29	8.67e-231	13	491	2	487
ATY67468.1|GH29	2.38e-196	36	491	32	476
UJR24945.1|GH29	1.34e-159	36	491	35	481
UJR12650.1|GH29	1.80e-154	36	490	34	479
UJR24914.1|GH29	2.58e-149	26	491	29	450

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GZA_A	7.10e-50	46	480	6	432	Crystal structure of putative alpha-L-fucosidase (NP_812709.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.60 A resolution [Bacteroides thetaiotaomicron VPI-5482],3GZA_B Crystal structure of putative alpha-L-fucosidase (NP_812709.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.60 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4ZRX_A	1.21e-36	42	456	24	427	Crystal structure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
5K9H_A	5.98e-34	49	460	38	436	Crystal structure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
3EYP_A	2.97e-31	49	368	9	317	Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
3UES_A	2.96e-25	50	457	19	446	Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7XUR3|FUCO1_ORYSJ	1.84e-32	47	464	37	451	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
sp|Q8GW72|FUCO1_ARATH	2.29e-30	47	457	35	446	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
sp|P49713|FUCO_CAEEL	1.58e-07	57	373	34	342	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.949003	0.051025

TMHMM  Annotations     

There is no transmembrane helices in KZZ98201.1.