CAZyme Information: KZZ97099.1

Basic Information

• Species: Ascosphaera apis
• Lineage: Ascomycota; Eurotiomycetes; ; Ascosphaeraceae; Ascosphaera; Ascosphaera apis
• CAZyme ID: KZZ97099.1
• CAZy Family: GT4
• CAZyme Description: Glucose N-acetyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A168CWT9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	AZGZ01000002|CGC1	41256.16	6.6945

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AapisARSEF7405	6442	392613	0	6442

• Gene Location: location=AZGZ01000002:611335-612614(-)

Full Sequence      

MLNPRSVRVWLIILLVVLLTTNLVLFQQKTLTSGCVLSSNYDSQPDTLLSAGLQNEIQGD
LGFSEALTGANTTHHVSEAWSKVAYVQYATDVTHLCNSVMIFESLHRLKSKPDRLLLYPS
QYSSEGGELASKLLRKARNEYGVNLMPVELQTKTGTDPTWRDSYTKLLAFNQTQYDRVLS
LDSDATILQPMDELFFLPSVPVAMPRAYWLYPEKPILGSHVLLVEPSSSEFRRVVEAIGR
TGANEYDMEVLNNLYKDSAMVLPHRQYSLLTGEFRSKSHAAFLGNKEEIFDPEAVLKAAK
YVHFSDWPVPKPFYEPEDDILKKYQPKCVRDYLRNIEDCRARSIWNALYVNFSQRQKVGF
PV

Enzyme Prediction     

No EC number prediction in KZZ97099.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	77	314	1.2e-19	0.8988326848249028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	1.05e-86	84	352	2	278	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133018	GT8_Glycogenin	8.91e-19	104	304	22	205	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
132996	Glyco_transf_8	2.56e-12	84	310	2	243	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
227884	Gnt1	2.60e-12	53	243	40	228	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX63128.1|GT8	1.38e-115	80	356	69	348
UPL00645.1|GT8	2.63e-108	80	357	85	363
QQK48387.1|GT8	2.02e-106	80	356	52	331
QKD58850.1|GT8	3.90e-106	71	357	120	408
QGI67415.1|GT8	4.55e-106	80	357	134	413

PDB Hits     

KZZ97099.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4HVS2|GNT1_GIBZE	1.69e-101	80	357	152	431	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q4WBL2|GNT1_ASPFU	2.28e-85	80	358	77	372	Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gnt1 PE=3 SV=1
sp|Q6BUZ2|GNT1_DEBHA	3.28e-25	80	354	65	456	Glucose N-acetyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GNT1 PE=3 SV=2
sp|Q12096|GNT1_YEAST	4.73e-24	80	358	89	488	Glucose N-acetyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GNT1 PE=1 SV=1
sp|Q6FQ15|GNT1_CANGA	6.82e-24	80	355	88	484	Glucose N-acetyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GNT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.751832	0.248175

TMHMM  Annotations     

Start	End
7	26