CAZyme Information: KZZ97067.1

Basic Information

• Species: Ascosphaera apis
• Lineage: Ascomycota; Eurotiomycetes; ; Ascosphaeraceae; Ascosphaera; Ascosphaera apis
• CAZyme ID: KZZ97067.1
• CAZy Family: GT4
• CAZyme Description: GFO_IDH_MocA domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A168CVU0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	AZGZ01000002|CGC5	42441.76	6.6522

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AapisARSEF7405	6442	392613	0	6442

• Gene Location: location=AZGZ01000002:522674-524073(+)

Full Sequence      

MAGTTPFKVRWGFIATGGIAAAFCKDLLIDSSVRGAGDVVHEIAAVASRSKDRAQKFVEE
MKIPSSPAVYGSYEELVKDPNVDVVYVATPHSHHFQNVMLCLKAGKHVLCEKAFTVNAEQ
TKILIDEAKKRKLFLMEAVWTRYFPICIQIRQLIRDGKIGEVLRVFADTSCGAPNAEEKF
GVEHRMVNPDLAGGVLLDVVLYSLTWCFQTLYHTQPKADRQPPSQITSQMEVYPKTGTDE
SVNILLTFPKSVPAGERRSQAIATGSLRITHNPGESEHVPCARIQGTKGEIEVYGMCYEP
KAFKLIPTKESGESEMTVKQEFPGGARGMNWEADEVARCLRDGKLESSTMDHEESLVIMK
TMDEIRKQGGLVYPEAIETTKLA

Enzyme Prediction     

No EC number prediction in KZZ97067.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	8	164	2.3e-19	0.38596491228070173

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223745	MviM	4.90e-53	8	367	3	330	Predicted dehydrogenase [General function prediction only].
396129	GFO_IDH_MocA	2.53e-23	9	136	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
275173	myo_inos_iolG	2.98e-13	42	162	28	145	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]
183212	PRK11579	6.14e-13	42	162	31	145	putative oxidoreductase; Provisional
182305	PRK10206	9.39e-12	52	181	35	164	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS38310.1|GH0	3.12e-10	43	207	56	218
BDC49873.1|GH0	3.12e-10	43	207	56	218
ABR38645.1|GH109	4.78e-10	42	164	87	214
QQY38775.1|GH109	4.78e-10	42	164	87	214
QHS52114.1|GH0	4.96e-10	8	252	32	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O48_X	1.89e-53	9	375	3	331	Crystal structure of Mammalian Dimeric Dihydrodiol Dehydrogenase [Macaca fascicularis],2O4U_X Crystal structure of Mammalian Dimeric Dihydrodiol Dehydrogenase [Macaca fascicularis],2POQ_X Dimeric Dihydrodiol Dehydrogenase complexed with inhibitor, Isoascorbic acid [Macaca fascicularis],3OHS_X Crystal Structure of Mammalian Dimeric Dihydrodiol Dehydrogenase in complex with Dihydroxyacetone [Macaca fascicularis]
3E9M_A	2.52e-27	8	368	5	318	Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]
3EVN_A	5.73e-25	8	253	5	236	CRYSTAL STRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]
4HAD_A	7.08e-19	9	365	24	338	Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_B Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_C Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42],4HAD_D Crystal structure of probable oxidoreductase protein from Rhizobium etli CFN 42 [Rhizobium etli CFN 42]
5A02_A	2.14e-18	43	344	34	335	Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A03_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A04_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A05_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A06_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A024SMV2|XDH_HYPJR	2.37e-132	1	379	1	377	D-xylose 1-dehydrogenase (NADP(+)) OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=xyd1 PE=1 SV=1
sp|Q9UT60|XDH_SCHPO	2.67e-59	1	380	4	366	Probable D-xylose 1-dehydrogenase (NADP(+)) OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dhd1 PE=3 SV=1
sp|Q9UQ10|DHDH_HUMAN	2.49e-53	9	375	3	331	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Homo sapiens OX=9606 GN=DHDH PE=1 SV=1
sp|Q7JK39|DHDH_MACFU	9.72e-53	9	375	3	331	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Macaca fuscata fuscata OX=9543 GN=DHDH PE=1 SV=1
sp|Q9TQS6|DHDH_MACFA	9.72e-53	9	375	3	331	Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Macaca fascicularis OX=9541 GN=DHDH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000002

TMHMM  Annotations     

There is no transmembrane helices in KZZ97067.1.