CAZyme Information: KZZ95602.1

Basic Information

• Species: Ascosphaera apis
• Lineage: Ascomycota; Eurotiomycetes; ; Ascosphaeraceae; Ascosphaera; Ascosphaera apis
• CAZyme ID: KZZ95602.1
• CAZy Family: GT22
• CAZyme Description: Glycosyl transferase family protein [Source:UniProtKB/TrEMBL;Acc:A0A162IKR8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
139	AZGZ01000004|CGC1	15988.25	6.3233

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AapisARSEF7405	6442	392613	0	6442

• Gene Location: location=AZGZ01000004:152221-152719(+)

Full Sequence      

MFLQDEIQGQNQPLNILENVDPNSDQQHQHPKRVWTTLITNTAYLPGLLTLAYSLQQVGS
RYPLIALYTDTFPPEGHAALDARGILKKRIPYLLPSVHKDYSNDVRFYDCWSKLAPFGLM
EYERVVQLDSDMMVVQKHG

Enzyme Prediction     

No EC number prediction in KZZ95602.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	23	136	6.2e-16	0.4785992217898833

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	5.93e-33	33	136	1	104	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
133064	GT8_GNT1	5.31e-07	39	137	7	107	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
215090	PLN00176	8.77e-06	31	134	21	125	galactinol synthase
279798	Glyco_transf_8	0.001	44	137	10	113	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS72023.1|GT8	2.23e-55	32	134	19	121
AYG85441.1|GT8	3.89e-55	33	136	13	116
QSS57188.1|GT8	4.45e-55	32	134	19	121
QIW95501.1|GT8	1.83e-54	33	136	17	120
BCR87299.1|GT8	2.14e-54	31	136	7	112

PDB Hits     

KZZ95602.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8H1S1|GOLS6_ARATH	1.51e-08	14	134	6	127	Galactinol synthase 6 OS=Arabidopsis thaliana OX=3702 GN=GOLS6 PE=2 SV=1
sp|Q5UNW1|YR707_MIMIV	1.79e-08	36	136	8	108	Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R707 PE=4 SV=1
sp|Q8GWB7|GUX6_ARATH	5.11e-07	14	136	12	131	Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=IPUT1 PE=1 SV=1
sp|Q9XGN4|GOLS1_AJURE	8.43e-07	36	136	27	127	Galactinol synthase 1 OS=Ajuga reptans OX=38596 GN=GOLS1 PE=1 SV=1
sp|O22693|GOLS4_ARATH	8.44e-07	24	134	13	125	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999994	0.000014

TMHMM  Annotations     

There is no transmembrane helices in KZZ95602.1.