CAZyme Information: KZZ95136.1

Basic Information

• Species: Ascosphaera apis
• Lineage: Ascomycota; Eurotiomycetes; ; Ascosphaeraceae; Ascosphaera; Ascosphaera apis
• CAZyme ID: KZZ95136.1
• CAZy Family: GT20
• CAZyme Description: Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:A0A168BCT3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639		71419.87	6.2202

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AapisARSEF7405	6442	392613	0	6442

• Gene Location: location=AZGZ01000005:464305-466224(-)

Full Sequence      

MKLSSTILLGALASLEGLAYARPASSSKGSFSYNNDTFLLNDKPFQIIGGQMDPQRIPRQ
YWRQRLQMARAMGLNTILSYVYWNNFEPTRGKFNFEGENDIAEYFRLAQEEGLHVVLRPG
PYICGEHEWGGFPGWLNTIKNMAVRQNNQPFLDEAKKYVDALGKQLRPLQITEGGPILMV
QLENEYGNFGGDKEYLEANAKMLRDNFQLPLYSTDNGRHETAVKGGQLPGVLSEVDGADP
HQSFAGREKWVTDPSSLGPLLEGEYYTTWFTWWGSNATRRHYDTASTMETVTDNVDWILG
NNNSLSFYMFHGGTNWGFQNGAMSQNGAVTAVTTSYDYAAPLDESGRPAKLYNEIRKLLV
ERYLPKDSVPEVPKVPPVATVPAFDLKPQGYMFDLLASAKKQKKDSPVIMEELGQSYGFV
VYEHKVTKGDTLKGVIKPGDKPRDRVIIYVQGKRVGVIDNIYPNPPDVSVNLKEGDLLQL
LVENVGRIDTSQPMKDQKKGIVGDVTIGGKTIKGWTSYSLPLDKAPQPKSSKNLNIESDS
SPVVFKGEFTLPKNSKFGLETDTFLNIPGGIKGVVWVNGINIGRYWNIGPQQSLYLPGAF
LKEKNEVVILELEPKNGTLSAEGINERKWFNNPDQDLKE

Enzyme Prediction     

EC	3.2.1.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	38	359	7.2e-98	0.990228013029316

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	9.15e-114	37	359	1	315	Glycosyl hydrolases family 35.
166698	PLN03059	3.67e-45	25	586	24	659	beta-galactosidase; Provisional
224786	GanA	3.89e-34	31	603	1	580	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
396834	Glyco_hydro_42	7.38e-10	54	187	4	139	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI19525.1|GH35	6.77e-249	18	636	14	634
QKX60376.1|GH35	2.08e-246	30	636	34	648
QLI69147.1|GH35	3.27e-246	18	637	18	642
ATY64919.1|GH35	8.25e-221	8	594	4	588
QRD02051.1|GH35	1.06e-197	24	636	30	633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAD_A	3.00e-117	35	612	21	578	Chain A, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
6EON_A	9.77e-115	24	612	21	593	Galactanase BT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	3.10e-109	25	611	2	572	Crystal structure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
3THC_A	8.88e-101	22	613	2	599	Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	1.62e-100	22	613	26	623	Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48982|BGAL_XANMN	8.29e-112	18	596	13	573	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
sp|Q3UPY5|GLBL2_MOUSE	1.30e-106	38	619	54	620	Beta-galactosidase-1-like protein 2 OS=Mus musculus OX=10090 GN=Glb1l2 PE=1 SV=1
sp|Q5XIL5|GLBL3_RAT	4.80e-105	19	611	30	613	Beta-galactosidase-1-like protein 3 OS=Rattus norvegicus OX=10116 GN=Glb1l3 PE=2 SV=1
sp|Q8NCI6|GLBL3_HUMAN	8.57e-105	38	611	80	637	Beta-galactosidase-1-like protein 3 OS=Homo sapiens OX=9606 GN=GLB1L3 PE=2 SV=3
sp|Q8IW92|GLBL2_HUMAN	8.32e-104	38	611	54	613	Beta-galactosidase-1-like protein 2 OS=Homo sapiens OX=9606 GN=GLB1L2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000263	0.999696	CS pos: 21-22. Pr: 0.9777

TMHMM  Annotations     

There is no transmembrane helices in KZZ95136.1.