CAZyme Information: KZZ95064.1

Basic Information

• Species: Ascosphaera apis
• Lineage: Ascomycota; Eurotiomycetes; ; Ascosphaeraceae; Ascosphaera; Ascosphaera apis
• CAZyme ID: KZZ95064.1
• CAZy Family: GT2
• CAZyme Description: Chitinase [Source:UniProtKB/TrEMBL;Acc:A0A168BB95]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		43027.08	4.8178

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AapisARSEF7405	6442	392613	0	6442

• Gene Location: location=AZGZ01000005:230510-231628(-)

Full Sequence      

MEGQFPSDVPNPLDKEDPPKKPMNEDEGSSGSDTVTSLSPPPHGRRRIWSLVDLYPRIIL
YHQTIYKNNGEDYVDLEFVFRANPGLTHLIIAAVHINEDPKKITLNDDPFDADKYVRFWV
QLEDVRTSGVRVMAMIGGAAQGTFERLDGPDREFERYYAPLRDVLKKYKFDGVDLDVEEL
MSQRGIQRLILRLRMDFGVEFIITLAPVCTALIPGQRHLSGFDYFTLEEEFGVCIDWYNV
QFYNGWGSPRFYPMLIKLGWPAEKLAMGVLTNPANGTDYLSIFRVGFYLTHILERYPDAG
GVFGWELFNALEHENLDAQEWIFRMALIYAMKRALDHEDGKLLIKAEKINMKQEIEDERL
ARGLEEERKKFQ

Enzyme Prediction     

EC	3.2.1.96:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	58	271	2.5e-19	0.6486486486486487

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119363	GH18_CTS3_chitinase	9.20e-115	57	310	1	256	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
119349	GH18_chitinase-like	7.48e-15	83	244	21	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
395573	Glyco_hydro_18	3.14e-13	85	284	22	243	Glycosyl hydrolases family 18.
119361	GH18_narbonin	1.02e-07	130	305	71	248	Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L.) cotyledons with unknown function. Narbonin has a glycosyl hydrolase family 18 (GH18) domain without the conserved catalytic residues and with no known enzymatic activity. Narbonin amounts to up to 3% of the total seed globulins of mature seeds and was thought to be a storage protein but was found to degrade too slowly during germination. This family also includes the VfNOD32 nodulin from Vicia faba.
214753	Glyco_18	3.04e-07	86	269	26	233	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM11529.1|GH18	6.31e-95	40	335	5	299
AAO88269.1|GH18	8.19e-93	40	335	5	299
EAL85921.2|GH18	1.03e-89	40	335	2	292
QSS58282.1|GH18	3.53e-89	56	321	13	282
BCR98952.1|GH18	1.61e-85	56	335	11	291

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8V_A	1.59e-90	40	327	4	286	Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_B Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_C Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_D Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293]
4AC1_X	4.46e-62	56	321	3	271	Chain X, ENDO-N-ACETYL-BETA-D-GLUCOSAMINIDASE [Trichoderma reesei]

Swiss-Prot Hits     

KZZ95064.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KZZ95064.1.