CAZyme Information: KZZ94015.1

Basic Information

• Species: Ascosphaera apis
• Lineage: Ascomycota; Eurotiomycetes; ; Ascosphaeraceae; Ascosphaera; Ascosphaera apis
• CAZyme ID: KZZ94015.1
• CAZy Family: GT17
• CAZyme Description: Alpha-L-rhamnosidase [Source:UniProtKB/TrEMBL;Acc:A0A168AJU4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
958		108256.01	5.4282

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AapisARSEF7405	6442	392613	0	6442

• Gene Location: location=AZGZ01000007:371920-374796(-)

Full Sequence      

MTLSFLRVGIHGFGEAIGIDSDSIRLYWSLKGSPPETKQTAYRVLISESRDALSSTSVSS
STEALVFDSGRINSSAQRNIPVQSPNAGAGFKSTTLHYYTVTVWDENDNASTSDVQEFYT
GYPRCSGLLPPYSMNQTYMPHSSLIFRTWFEDEANRWKAVWIGDGGDKPIYIRKSIPLKK
GEGKGDIERVFAFASGLGHFNLTVNGHRPQYDGKKHMIDPGWTNYHRTVQFVGYDLTPYW
HRSAENENESNGENVIGAHIGNGFYAGDKGAEDRFFWPMYEDNTYVRYGNELCFFAEIHI
HYKSGEHEVIISDPSWKVRKSATTLANIYNSEDCDLREYPNGWDQRGYVEDDKWASAKPV
TGPRGRIRYQSQPPVVLHQLMPVQSVKEVRPGVAIYDLGQNASIHISLAFVGGEAGSEVV
IRSSETISSQGELCMPDELFSKFQTGVYHRVKLRGTGTSEAPETWEPDFCFTSARYIQVE
NVCLPKSSTIANDLPIIYGLEVHHISSASRPLGHLQTDKEDINALINACQYTFSSNFFSY
HTDCPQIEKFGWLEVTTLLFPATQYIRDAEALYAKILDDILDAQESSGLVPTMAPEMRYM
AGPLHDTISWGCAIAVLPELIKKYYGWTGVITEKLFAGAMRYMEYMRTRERRGGLIEHGL
GDWGVGIAFGNHQANLETAMYHRCLKACEMMAVELGKSKEEVKGLKKWAERVKEVYNREL
LVTDKSQYGYAYYTSLDEPGARDRTMVAQAVAIQCDMVPASYRPDIIRAFIAAAEDSENV
MKAGELGLRYLWATFAMPEVNRPDIVLAMCRQDEHPSYMRFLRRGETTLSEFWQDECRSK
CHDMLGTIYEWMYAYVMGVTVVEDGWKVWRLRVPVKSEFNAVEGTVDCPYGTVGVRWKRD
EDDSDNMIRGVVEVPTSTRCVIEVEGKEILARRDGAGEERGSDRVEIGAGEWELLVKR

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	386	923	1.9e-98	0.996031746031746
CBM67	168	361	2.8e-17	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	4.39e-85	513	856	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	6.49e-55	185	379	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
336149	Bac_rhamnosid	1.95e-13	387	482	1	87	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	5.95e-08	858	941	1	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
397089	Chal_sti_synt_C	0.009	643	670	109	137	Chalcone and stilbene synthases, C-terminal domain. This domain of chalcone synthase is reported to be structurally similar to domains in thiolase and beta-ketoacyl synthase. The differences in activity are accounted for by differences in the N-terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW35313.1|GH78	0.0	3	938	1	895
QRD91716.1|GH78	0.0	3	938	1	895
QMW47375.1|GH78	0.0	3	938	1	895
UDD64414.1|GH78	0.0	3	938	1	895
EAA67087.1|GH78	0.0	7	956	5	912

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	5.20e-52	17	958	44	943	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.46e-50	187	957	316	1031	Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q82PP4|RHA78_STRAW	2.15e-49	187	899	316	973	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999985	0.000050

TMHMM  Annotations     

There is no transmembrane helices in KZZ94015.1.