CAZyme Information: KZZ93178.1

Basic Information

• Species: Ascosphaera apis
• Lineage: Ascomycota; Eurotiomycetes; ; Ascosphaeraceae; Ascosphaera; Ascosphaera apis
• CAZyme ID: KZZ93178.1
• CAZy Family: GH93
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A167ZWC2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
833		91907.97	5.1245

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AapisARSEF7405	6442	392613	0	6442

• Gene Location: location=AZGZ01000009:502133-504770(-)

Full Sequence      

MVAFERFDVEKALEELTLQEKIALTTGADFWHTVPVERLGIPSVRLSDGPNGARGTRFFD
SVPANCIPCGTGLGSTWDAELMREVGQFLGKEARSKGAHVLLGPTINIQRHPLNGRAFES
FSEDPLLSGTIAGQYCLGLKDEKIIATPKHLVCNDKENERFGSDSVVSERAMREIYLTPF
QIALKEGNPRTIMTAYNKVNGTHASENKGLIQDILRGEWGYDGLVMSDWFGTYSTSESVN
AGCDIEMPGPSRFRGDILEHAVLAKKVPRHVLDDRVRNVLNLVNEAVECGIPESAPETTI
DTPEARAFMRKVAANSVVLMKNQNNILPFDKNKPVLVIGPNSKVASYAGGGSASVTASYT
VTPYEGVCNASNAEVAWTQGVYSHRALPDFGPMLRTPEGKQGFLFRAYNEPPSVADRECI
EMRTMRKSESHLSDYKNDKLKGEEWYATIVSTFTPEESGLYDFGVVVIGSGRLFIDEELV
VDNTHDQKQGTLFFGMGTEEVIGSKELVAGQTYNVRFEFGSTPTGDLKVANNAEKNGAFR
MGCAKRIEYDISIKQAMEMASKYEQVVCFAGLNGEWESENIDREHMDLPAGSDDLIKAVL
AGNPNAAICIQSGMPVTMPWADDTKALLWASFGGNEIGNGIADVLYGNVNPCAKLPVTFP
RRVQDNPAFLNFGVDGGRILYGEDVYVGYRFYEKTEKDALFNFGHGLSYTTFSRENLQVA
EDGEKLTVKVTVKNTGAVAGAEVVQLFIHPKSAAAVRRPVRELKAFKKVMLEAGESKDVE
FDLEVKRVTCYWDEIRHEWCSEKGTYEVQIAGTGDKDVRAKFDVKKSTWWKGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	36	248	1.2e-67	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.21e-78	38	823	101	763	beta-glucosidase BglX.
224389	BglX	1.23e-74	38	376	57	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.00e-44	533	689	61	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	9.76e-40	34	282	59	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.55e-35	16	781	60	740	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATQ35958.1|GH3	0.0	6	833	3	839
AJA36818.1|GH3	0.0	6	833	3	838
QKX61249.1|GH3	0.0	6	833	3	839
BCS04055.1|GH3	0.0	6	833	3	839
BAE61980.1|GH3	0.0	6	833	3	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.10e-269	6	833	3	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.97e-264	6	833	3	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.29e-134	8	825	4	667	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.27e-118	12	820	8	657	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	7.73e-98	9	821	4	708	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WU49|BGLI_ASPFU	0.0	6	833	3	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	0.0	6	833	3	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	0.0	6	833	3	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A2R989|BGLI_ASPNC	0.0	29	833	5	818	Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	0.0	6	833	3	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999876	0.000180

TMHMM  Annotations     

There is no transmembrane helices in KZZ93178.1.