CAZyme Information: KZZ92676.1

Basic Information

• Species: Ascosphaera apis
• Lineage: Ascomycota; Eurotiomycetes; ; Ascosphaeraceae; Ascosphaera; Ascosphaera apis
• CAZyme ID: KZZ92676.1
• CAZy Family: GH76
• CAZyme Description: UDP-glucose:glycoprotein glucosyltransferase 2 [Source:UniProtKB/TrEMBL;Acc:A0A167ZHP9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1469	AZGZ01000010|CGC4	165402.75	4.6252

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AapisARSEF7405	6442	392613	0	6442

• Gene Location: location=AZGZ01000010:205243-209709(-)

Full Sequence      

MARSSCLLQSAWLQVFAILLSSLLVVVSGDQSVNVALRAPFNNPPYLLELLETAAQENES
CYFSLLDRIADGALSETTNDQELYSAFKQLLQEDGHITSKSALSLFDFSLALHSAAPRIE
AQYQFYNTSVGPTVTAAQDAACPVWAHYEGMQYCSPTLERAQQDGPAIENMKFLPFDRVL
GDPEAPGLVLYADVLSPQFREFHQEISQRAKDGEISYRLRYRPSAHGPSEPLMMNGYGVA
LNLKRTDYIVIDDRTAEQENDKKEDEKTSADSDDLQPLSASELSQLGLRAASFVLNSEDP
FKTLVELAQDFPRLSNALANHDIDESFIAEHQQNQEKFLRPGLNQIWLNGLPLDDEDDVD
GFHLLEHLRREQALVNGLQDVGFTGKEAVDVISSTLSASSGPSDDNLRFDYRDDREENEV
IIWLNDLEKDERYANWPSSVLSLLRATYPGQLSPIRRDIHNVVIPVNLTDVDDIKLVTST
IRMFINKRIPSRFGLAPSVSRDGSIPIVKVAHYIADTYGPMALLDYLEKSLAKGTSSIPS
ESILRKVVAGLEPLDNKQPLQFDEVLAGSRYDSHIENTRSYFRRLAIEPGDSGAIFFANG
IPLPRDDDFLQSMAMSLTRDLHMMRQLVYQEVYDEDSWLPNYYLEHALLGRNPIVAPEDD
TKIKVYDMNDIFKTHPQVLDSLTRIPASEDSLIREWASVIFVADLDSTIGRDQLQYLLKF
KEENPALEISLLHSLQSLGDISSQLSQKGDMAISTVSSVLTSENALSTPRDLDEDAWFSI
KALLNSFGLSDGDTALIYNGRLVGPLHSSSILDSTDLNILQHFEKSKRLNQAVEALETLG
LVEKITSPSQLARLTSHLALAAEDTSTQAVFDTAPPARSDIFKQWSSDHSSITVSNSDEP
IIFINAVVDPASEMAQRYLPILKVLSEIEGVQVHILLNPQNELQELPVKRFYRQVLTSAP
SFDVNGKLSTPRAEFRGIPKQALLTLSMDVLQAWLVAPQESIYDLDNLLLNSVKEGSDVD
AIYLLEYILVEGHSRDTTLKTPPRGVQLLLGTENEPHFMDTIIMANLGYFQFKSRPGYWK
ITLKPGPSEDIFSLDDIGANAIQGGTEEEGNHLTLMSFQGKILFPRLSRKKGQEKSDVLS
SSSNSGSARDYLSRGMGFASSLFSNSRPEAKANADINIFSVASGHLYERMLNIMMVSVMR
HTTHTVKFWFIEQFLSPSFKSFLPHMAKEYGFEYEMVTYKWPHWLRSQREKQREIWGYKI
LFLDVLFPLSLDKVIFVDADQIVRTDMYDLVTFDLEGAPYGFTPMCDSRKEMEGFRFWKQ
GYWKNYLGGLPYHISALYVVDLVRFRALAAGDRLRGQYQALSSDPNSLSNLDQDLPNHMQ
RILPIKSLPQDWLWCETWCSDEALKTARTIDLCNNPLTKEPKLDRARRQVPEWTAYDEEI
AALAKRVAQTKEPVRESGESEEGIVHEEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1176	1423	1.3e-133	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133054	GT8_HUGT1_C_like	0.0	1176	1423	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408203	Glyco_transf_24	0.0	1176	1443	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
408201	Thioredoxin_14	1.93e-78	409	655	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
132996	Glyco_transf_8	2.64e-58	1176	1423	1	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408199	Thioredoxin_12	5.92e-55	44	230	2	185	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS69256.1|GT24	0.0	28	1455	29	1474
QSS63494.1|GT24	0.0	28	1455	40	1485
QSS51253.1|GT24	0.0	28	1449	29	1468
CAK39488.1|GT24	0.0	17	1452	15	1464
CAS97678.1|GT24	0.0	17	1452	15	1464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	27	1451	5	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	27	1451	5	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5Y7O_A	0.0	29	1139	2	1123	Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii],5Y7O_B Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii]
6TRT_A	0.0	27	1451	5	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	27	1451	5	1221	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	6.72e-272	20	1443	9	1424	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	8.18e-247	17	1447	10	1511	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	2.02e-240	26	1464	40	1555	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q6P5E4|UGGG1_MOUSE	1.56e-237	28	1443	42	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	2.19e-237	28	1443	42	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000201	0.999790	CS pos: 29-30. Pr: 0.9739

TMHMM  Annotations     

Start	End
7	29