CAZyme Information: KZZ92289.1

Basic Information

• Species: Ascosphaera apis
• Lineage: Ascomycota; Eurotiomycetes; ; Ascosphaeraceae; Ascosphaera; Ascosphaera apis
• CAZyme ID: KZZ92289.1
• CAZy Family: GH5|GH5
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:A0A167Z7W4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
883		96275.93	6.2959

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AapisARSEF7405	6442	392613	0	6442

• Gene Location: location=AZGZ01000011:201882-205242(+)

Full Sequence      

MNDGIHAKAKANMIEHPITFGEPLSLSLPSVQSSLRHRLAARQSLVSRSTRTPSIANQAD
AVLSPPSNISSHLIGSDYPYITSVIPVDGGFAEASATAGNTFAPEISTLTIGYQSRPSTL
DSPATAVSSITKIIPTVNPTVITTATASATIAPTVPGFSGNPSRNGTDNMAGQDIFMPIS
YDRPPASIPVNRNHPLRKQHIVNNGTTPTNKFFANMFLGTQTMPVFTHPYSLVFTKGSNN
AVGIGVSHIDRSLLTLGPAQRELPGAPARFYLNPMGIWSFVLSAKEFDDSTSLTVTEPTA
FSANAVLSRGNGTITFPMLQGMGFVTAQYSGNLTPLLSTIVFFRNMTPAGTVNGASKYRV
TLENNCTWLVYASAYDRSPTNLTLTGNNTITGPSNFRGIIQIAKNSGGHDEENIFDYAVG
NYATTMHVAGIVEGNTGKYKFLWTKAGMNPSAPLLMYALPHHVESFDQNTRINVTNLKLQ
TTTKGEATAVLGDSWTMEENDLPIEMDFAPYKPGKSTVEFSDAVKAKIMNAARSELQQDM
AQNTDVSSMYFSGKGLAKYAFILYTVQGLLKDAAAAQDGLNRLKQSFATFIENRQQVPLY
YDDEWKGVVSSGTYNTGDPNADFGNTYYNDHHFHYGYFVLAGAIIGRLDPSWLTQQNVGY
VNTLLRDAGNSVPDDPYYPFSRGFDWFHGHSWAKGLFESADGKDQESTSEDTMFAYAVKM
WGKTIGDASTEARGNLMLGLLRRSLNNYFLMASDNNVQPRPFIDNKVTGILFENKADHTT
YFGTNLEYIQGIHMLPLFPASPYVRSEKFVDEEWQAMFAENATAPASRVEGGWKGVLYAN
DAIRDARESWNFFAQPNFNSSWLDNGASLTWSLAFAAGLGGAP

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	200	875	2e-221	0.9790996784565916

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	185	883	66	759	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	520	873	2	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	1.72e-132	194	513	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABH10633.1|GH81	5.97e-284	170	883	1	718
QQK39657.1|GH81	1.18e-280	165	883	228	951
UDD56325.1|GH81	2.08e-280	172	882	7	724
QRD82801.1|GH81	1.26e-277	172	882	193	910
QMW28320.1|GH81	1.26e-277	172	882	193	910

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.63e-105	172	877	5	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.92e-105	172	877	30	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	6.73e-101	172	877	5	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	8.68e-28	205	861	33	645	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5T49_A	6.95e-20	599	817	438	648	Chain A, BH0236 protein [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	6.84e-293	159	878	175	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	2.12e-175	174	883	2	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	3.23e-161	174	879	401	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.21e-155	209	879	84	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	9.03e-155	159	876	61	775	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KZZ92289.1.