CAZyme Information: KZZ89866.1

Basic Information

• Species: Ascosphaera apis
• Lineage: Ascomycota; Eurotiomycetes; ; Ascosphaeraceae; Ascosphaera; Ascosphaera apis
• CAZyme ID: KZZ89866.1
• CAZy Family: GT90
• CAZyme Description: TPR Domain containing protein [Source:UniProtKB/TrEMBL;Acc:A0A167XBC6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1947		213726.52	8.3721

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AapisARSEF7405	6442	392613	0	6442

Full Sequence      

MRPAVLQLSPKVDQDPFAFHAAQQQQHQHLQQQQQQQQQLQQQQYPLAAPELHRGSFKAD
SIKDSFPPANSTTARGAANVPIDSSTHAAGFETSNEVNRTGRPAPPPNYIPLPSPLPPSD
YSLRRKTPNGTLAAGYDGSPDEGKGAIQPPAPKHIRMSNADGNLMRTINAQRDIGQTIPI
ATGQVQPRDFRQGADMHVSNYLAQGAPIGQNANMSSRQGGADNSKPSDYRSISQAQLQAQ
NQLYGHQFGNFRAPSSANPGGHAQLQVLNQPHALPIQGQHTSAINNWPYPSYQSSASIPI
ANNVGQLSNVYQFNGNVPFLQQIQQQHSQQPPQQPQHPVIPTVLPYVYQQPSPGPTASAG
VSPYGPYWPDGAFIPYRPAAFRDARFLSHNGLASGGLPTMEHHLASLQNAQGGLGLLPQQ
AGLVAHPGDRTSNFGISTDLLGGSNPAAAAGITENTAPLFQADCNTGLANSNVLQQAQTT
PASVLNNWDQTLMPSQQTLRHQHRSIQQHLGQQQNQVRPQQQQQQQHQQQQHVPHTQDPH
INAMLNQMQPLQQHRAANAASTGWEIGGNLTLPFHTKLQNTGSNSSAPRYLQQVQNQGPN
VLQRVQQKPADLLSIPWQQQQRQQQLNQNQVPNSLPGILPFSTLPSTSVTPAALSIPSYS
QATNREEFKENVLTWAHGVYIELLAYIHHTSRRNDTVNIGGVNVNINTGATSKPKPSIYP
KPPRPLNASHVSSASQALASSAASIASPITPSTAASATQLLGLGQMTLSSPVTNAKTALD
LLSSLCVESDWKWIEGALLGGCLAYGLEDYEKAWRWYSRILRRDPKHVEALSNLAATLLA
LDKKDEALEMWKQAVKLRPSYFEAVEHLIGLLCSSGRARQAVEVINFVENSLRLGVDDDQ
AAQGKRRTSAAGNHTANENDSLERSAKESSTAPPSIKSQSTQNTASDGSSDNSKNKSRSD
AQYPNNQPGFGTSGYAIAGADNGRMLALIHAKGNMLYALGQNFAAAAAFEDAVLIGAGRG
RKGGVKGLIKKIVAAFLAEFEGRRADTPSVDQIDISTQIILLYPTRALQTAKLVFPDNGA
VPGFQYIPEGLAKKAAISTMSNSLLSLSKIYQDSMAAPAPHDAKASSAKATTVGDILALY
YLSLSLQPSPSTANNVGILLASIQQGSNTKLLRSANETVMPENLISGVVPNSSIALALSY
YYYGLNLDSKHAHLYTNLGSLLKDIGHLAHAIRMYEQAVQCEPNFDIALANLANALKDSG
RVNDSIVYYKRAVQANPDFAEAVCGLANSLNSVCNWIGRGGIATTRGVKDRWHVDEKGAL
VDSRNVGVDSGWIKRVVDIVEKQLKEGRSWGCGLLKSLGLDQNPMLVLAQLGIRVMSSED
NDDAVFNLKKATEFAILLKSWSGHSWEGARVVRLVERAIRYIGWRWYQDKYIHKKDCSPA
KYARPRLPVTLSPPNAPTVLPFHTFTTPLSAKQIRHISQRNGLRISCSTLQAPWLPQSVY
RPPAPPDPCLNVGYVSSDFNNHPLAHLMQSVFGLHNPKRVKAFCYATTPGDGTVHRKQIE
QEAPVFLDVSSWSIDRLVQQIVNDGIHILVNLNGYTRGARNEVFAARPAPIHMSFMGFAG
TLGAEWCDYILSDELSIPLNALSRSPRNLTLEEQVTEPDHAEDQDDWIYDERIVYTRHSF
FCCDHKQSAPDCQERDVTFEAELDRRWKMRKEMFPNLSDDFIILGNFNQLYKIEPTVFRT
WLRILAAVPNAILWLLRFPEPGEKNLRQSALAWAGEEVASRIIFTDVAPKRLHISRARIC
DVFIDTPECNAHTTAADILWSGTPLITYPRYSFKMCSRMASSILSSAFPVGKEGRDAASQ
LIVSSDEEYEARAIELCRELRYLSPGRPSGRLADFRKLLFTNRFQAPLFDTRRWVEDLEE
AYEAVWNKWVKGEEGDMWLPRGVEATA

Enzyme Prediction     

No EC number prediction in KZZ89866.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404688	Glyco_transf_41	1.86e-102	1457	1918	28	543	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
226428	Spy	7.57e-61	1510	1927	260	616	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
276809	TPR	7.93e-14	801	883	8	90	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	1.91e-13	1197	1274	20	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	3.88e-13	1212	1290	1	79	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS19035.1|GT41	BCS19035.1|GT41	0.0	340	1939	217	1646
BCR84337.1|GT41	BCR84337.1|GT41	0.0	656	1939	362	1607
QQK40230.1|GT41	QQK40230.1|GT41	0.0	119	1939	78	1642
QSS71677.1|GT41	QSS71677.1|GT41	0.0	266	1939	131	1696
QSS56838.1|GT41	QSS56838.1|GT41	0.0	266	1939	131	1696

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TKA_AAA	6TKA_AAA	2.52e-76	1457	1946	184	724	Chain AAA, UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit [Homo sapiens]
5LWV_A	5LWV_A	3.93e-76	1457	1946	206	746	Human OGT in complex with UDP and fused substrate peptide (HCF1) [Homo sapiens]
5LVV_A	5LVV_A	3.93e-76	1457	1946	206	746	Human OGT in complex with UDP and fused substrate peptide (Tab1) [Homo sapiens]
5NPR_A	5NPR_A	5.04e-76	1457	1936	179	710	The human O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]
5NPS_A	5NPS_A	5.14e-76	1457	1936	180	711	The human O-GlcNAc transferase in complex with a bisubstrate inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Y0|SEC_ARATH	sp|Q9M8Y0|SEC_ARATH	6.05e-88	1457	1934	535	960	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
sp|Q8CGY8|OGT1_MOUSE	sp|Q8CGY8|OGT1_MOUSE	4.90e-74	1457	1946	503	1043	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
sp|P81436|OGT1_RABIT	sp|P81436|OGT1_RABIT	1.56e-73	1457	1946	503	1043	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
sp|O15294|OGT1_HUMAN	sp|O15294|OGT1_HUMAN	2.08e-73	1457	1946	503	1043	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
sp|Q27HV0|OGT1_PIG	sp|Q27HV0|OGT1_PIG	4.95e-73	1457	1946	503	1043	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa OX=9823 GN=OGT PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KZZ89866.1.