CAZyme Information: KZZ89578.1

Basic Information

• Species: Ascosphaera apis
• Lineage: Ascomycota; Eurotiomycetes; ; Ascosphaeraceae; Ascosphaera; Ascosphaera apis
• CAZyme ID: KZZ89578.1
• CAZy Family: GH20
• CAZyme Description: Chitinase [Source:UniProtKB/TrEMBL;Acc:A0A167X387]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	AZGZ01000020|CGC1	46868.25	7.3893

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AapisARSEF7405	6442	392613	0	6442

• Gene Location: location=AZGZ01000020:302279-303792(-)

Full Sequence      

MMFSKLSVMPLLASLTAARFVAYIDQDHNSTLPSKSLTGEIDHVILAFVQSSMLYNESTI
VKWWDLPKIKSHFKENTTFMVSIGGDPDFKQGFHKAVQSDESRKSYARKVANFVKREGFD
GVDIDWKYPGGITENETVEIRGFPSLLQEIRKAIGKNMTLSIASPGVKKYMHAYTRQHAP
NIFNAVDFLNILTEDQMDNFSNTTDYLSGISSCNDTISAYLELGMPPEKGNLGMPFYGQG
YSVEPDCKHGLGCKVVKPGEKKGKVVGQVSSFMWTAMYMDANPPSKNASVAKDGEMCGPD
TKKICPGKACCSPSGYCGTTEDYCGWNCLPAWGHCNGSTSIGSFQKARKDKSAVTDQGAF
YLDKENNFFWTWDPAENYGDKYHTVIKDNKLGGVMVWSLGEDSYDWSHLKKLSAVIKQHR
M

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	20	405	6.9e-44	0.9391891891891891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	1.04e-46	19	402	1	307	Glycosyl hydrolases family 18.
214753	Glyco_18	5.27e-37	21	402	3	334	Glyco_18 domain.
119365	GH18_chitinase	7.92e-31	80	240	88	265	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119349	GH18_chitinase-like	3.50e-27	20	195	1	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119351	GH18_chitolectin_chitotriosidase	2.10e-25	43	399	30	338	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIW06010.1|CBM18|GH18	2.53e-96	2	413	1	417
QSS57709.1|CBM18|GH18	2.38e-89	15	410	15	421
BCS22836.1|CBM18|GH18	3.46e-89	19	418	20	429
QQK48241.1|CBM18|GH18	5.31e-89	14	412	14	421
CAP85554.1|CBM18|GH18	5.29e-88	2	417	1	422

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Y2A_A	2.30e-15	43	260	34	271	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 2 [Ostrinia furnacalis],5Y2A_B Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 2 [Ostrinia furnacalis]
3WKZ_A	3.31e-15	43	243	38	260	Crystal Structure of the Ostrinia furnacalis Group I Chitinase catalytic domain E148Q mutant [Ostrinia furnacalis]
3WL1_A	3.31e-15	43	243	38	260	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with reaction products (GlcNAc)2,3 [Ostrinia furnacalis],3WQV_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)5 [Ostrinia furnacalis],3WQW_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)6 [Ostrinia furnacalis]
6EPB_A	5.11e-15	33	241	56	297	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
3W4R_A	5.51e-15	43	243	56	278	Crystal structure of an insect chitinase from the Asian corn borer, Ostrinia furnacalis [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9D7Q1|CHIT1_MOUSE	1.65e-16	43	259	53	289	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2
sp|P36362|CHIT_MANSE	2.84e-16	43	257	54	291	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|P32470|CHI1_APHAL	1.42e-15	76	241	121	297	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|A6N6J0|CHI46_TRIHA	1.13e-14	33	241	57	298	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
sp|P48827|CHI42_TRIHA	2.63e-14	33	241	56	297	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.584676	0.415314

TMHMM  Annotations     

There is no transmembrane helices in KZZ89578.1.