CAZyme Information: KZZ87612.1

Basic Information

• Species: Ascosphaera apis
• Lineage: Ascomycota; Eurotiomycetes; ; Ascosphaeraceae; Ascosphaera; Ascosphaera apis
• CAZyme ID: KZZ87612.1
• CAZy Family: CE4
• CAZyme Description: GPI mannosyltransferase 1 [Source:UniProtKB/TrEMBL;Acc:A0A162IDU0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434	AZGZ01000032|CGC1	48494.02	9.6520

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AapisARSEF7405	6442	392613	0	6442

• Gene Location: location=AZGZ01000032:153970-155482(-)

Full Sequence      

MSTMPPIPSPFSSQSTLLTLAILLRTGLFSYGLYQDAHFPAKYTDIDYLVFTDAARFVSQ
GGSPYERATYRYTPILAWLLLPTARDGDSSSSWAWLWFSFGKGLFAAADILAGWLLIKIM
RKHMRVEDSRALKYVGCGWLLNPMVAVISTRGSAEGLLGVLVVALLWAVLEKKLVLAGAL
LGFGVHFKIYPFIYGMSILWALDEGMSNEMTLRTFSRPWRLLNCSRVKVLLTSLAVFLGL
NAWMYSIYGGEFVQHTYLHHFTRVDHRHNFSPYNMLLYLSSASSAAGTAQGISFESLAFL
PQLSLSAVLIPLVLAKMELAGCMLAQTFAFVTFNKVCTSQYFLWYIIFLPLYFTYSSFLT
KPVTGLIALVAWVGTQALWLQQGFKLEFLGQSTFTPGLFLSSILFFLTNVWILGVIVGDV
ARYTAAPVRGWKKG

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	148	417	2.8e-91	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.31e-77	8	417	2	415	GPI mannosyltransferase
252941	Mannosyl_trans	4.90e-68	148	417	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS74503.1|GT50	1.90e-181	7	420	1	414
QSS62928.1|GT50	1.09e-180	7	420	1	414
QSS50664.1|GT50	1.09e-180	7	420	1	414
QKX64577.1|GT50	2.23e-165	9	433	3	428
QGA12480.1|GT50	4.49e-165	7	434	1	421

PDB Hits     

KZZ87612.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB8|GPI14_ASPOR	4.20e-157	9	421	3	411	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	5.86e-154	20	420	14	428	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	1.28e-153	11	420	5	421	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	7.09e-150	6	422	2	410	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	3.31e-146	2	422	3	487	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.944687	0.055335

TMHMM  Annotations     

Start	End
15	34
95	117
147	169
174	196
227	249
270	292
307	329
342	373
393	415