CAZyme Information: KTW29079.1

Basic Information

• Species: Pneumocystis jirovecii
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis jirovecii
• CAZyme ID: KTW29079.1
• CAZy Family: GT20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1491	LFWA01000010|CGC2	175424.34	5.9507

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PjiroveciiRU7	3811	1408657	50	3761

• Gene Location: location=LFWA01000010:227944-233188(+)

Full Sequence      

MPPFVNLFLETVAAQNESLFFPLLDIISKEKHMILSKLNFDNYNYLRNLVYDYKIMRDNI
SLSILDYALALHSSAPKIQAYYNYYNDVVVSEMISRNFTSECKNWILFNGRQYCDIDKFL
ESKDIKGENFKPVTLLSFDHIFDNNKNGDSPLAILYADLSSNNYITYHSFLYEKAKLGDL
KYVFRYKPEDFNSNDSLYLSGYGVEASLKKTDYLVMDDRKIIEDVHEKMPSQSYSSEVNS
SFFFSNIQDNEIKSLTNTELKELGFSITQFVMESKTPLETLNYILQDFPKYASYLSTIKI
NKKTLKKLTLNYKYLNPGETVFSINGLKIKLDKINGFSLLKYLRKEYDLISSLQNLGLSL
EKAKSLITDKAISELFNMFLNIRFDFRDSYDDGNVILWLNDIENDPTYMHFSQDIYQYLD
ELPNGELHMIRRNLHHVIIPLDFSKKFDMIFFRDIFFFIQRLFPIRFGILPVWQDPKDIF
LVKIFYHLFSTYGINSAIEYILYLDPDSRHNETILSRNYNFILFKYEQDIEIEDLDINNI
IKSKKIEQYILKTKEWSLRLGIENDDFLIVNGKFLEKKQVYICTRFLFFLFTTKLVLTIQ
IVEKSLNNNVNILDYLLEDAVYRRDSYVHPMGKIIKSLKLNDYIFNQQNIRFSSINENLN
TELSFWLIADFDTKKGLEFAKFALEYMIEHPYTSLRFLHNPKLSNKNNFDYFSSFLFLLS
EKNIDVTESVLNYIQKLLNSYDSDGIINREIEYPYFILNIYNSTELLLNSVKAKLYWEKM
KDQLDKLEFSPGEFGLLANGHVIGPFPESYDSLFDSFKLLGDFHNFSIISQLKTITERLD
IKNSRCKMFFPVLFSILLSHIVFEKYDFTYFSQFGRDKIYTLTQKLTPSFTSGNQRNSAF
EVKVVLDPLNEISQKLVPVLKVLEQMEGVYIEVYLNPLQKISKLSINRFYRYVLQSSLKF
NIDGDLIYPSAIFERLPISHLYTIDYDFPGSWIVTQKRSIYDLDNLLLSDLFSKKIKEVV
VIYELKYILIEGHAEEIGLKTPSGIQLALKTKNNIFITDTIVMSNFGYFQFKANPGVFKI
DIITKESNDILKILKISDKLGSNNFKKEIILESFEGLTIFPTFIRYSGKNRILNLEELNK
FEDNDFELENTTLKFMQSKHSSGSTFDIPVQKFHAEINIFSIASGHLYERFLYIMILSVL
KHTKHTVKVWFIENFLSSSFKNFLPYVANEFGFQYELITYRWPYWLRSQKEKQRQIWGYK
ILFLDVLFPLELDNIIFVDADQIVRTDLKELVDMDLQGAPYGYTPMCDSRKEMEDYRFWK
KGYWKSHLKGKPYHISALYVVDLKKFREIGAGDILRQHYQALSQDPESLSNLDQDLPNNL
QDLLPIFSLPQNWLWCKTWCSDESLKDAKTIDLCNNPMTKESKLERARNQVPEWNEYDKI
VANLIARILEQRNNEASESSVDNIAISVDVMENIQFNSGEENKKKSIHDEF

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1177	1424	8.9e-129	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1177	1444	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	3.36e-167	1177	1424	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	7.95e-56	1177	1417	1	241	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408199	Thioredoxin_12	6.67e-48	2	188	2	178	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408201	Thioredoxin_14	2.32e-39	384	628	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL64450.1|GT24	0.0	2	1490	42	1354
BCR85402.1|GT24	9.32e-294	3	1462	43	1466
QRD91624.1|GT24	1.11e-293	3	1458	43	1470
QMW47293.1|GT24	1.11e-293	3	1458	43	1470
QMW35231.1|GT24	1.11e-293	3	1458	43	1470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	2.09e-273	2	1452	22	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	1.62e-272	2	1452	22	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	8.88e-272	2	1452	22	1455	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	4.66e-235	2	1386	15	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	1.32e-219	2	1452	22	1221	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	2.88e-252	62	1458	91	1438	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU1|UGGG2_HUMAN	9.71e-207	10	1445	54	1499	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4
sp|Q6P5E4|UGGG1_MOUSE	6.83e-201	63	1444	116	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	7.65e-200	63	1456	116	1535	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	5.38e-197	63	1444	116	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000072	0.000006

TMHMM  Annotations     

There is no transmembrane helices in KTW29079.1.