CAZyme Information: KTW28757.1

Basic Information

• Species: Pneumocystis jirovecii
• Lineage: Ascomycota; Pneumocystidomycetes; ; Pneumocystidaceae; Pneumocystis; Pneumocystis jirovecii
• CAZyme ID: KTW28757.1
• CAZy Family: GH81
• CAZyme Description: GPI mannosyltransferase 2 [Source:UniProtKB/TrEMBL;Acc:A0A0W4ZK76]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	LFWA01000011|CGC1	48325.45	9.6703

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PjiroveciiRU7	3811	1408657	50	3761

• Gene Location: location=LFWA01000011:393657-394969(-)

Full Sequence      

MQLIDLLILTISFLVYKVIFILIPVLSSFLNVYDTSTLLILEKPKNILQKIIVSLVRWDS
VYFIILARRGRLFEQEWAFGPVFPHTVRLFTDHIFLSKSLYNYAFLSIVISHLFHLFSIF
SLYYLTFKIYQSRNMAIITSFLYLVSPSGIFLSAGYTESFFSFFIFTGFIFFEKDYNFLA
SLAWCVASTIRSNGLLWSIFFLHSAFIWVCRFFKYPGFILFFRIIKFGICSLIVGIGFFW
IQYRAYVEFCHPEKKRSWCFESFPLIYSFVQSYYWNVGFFKYFTLPQIPNFILVSPAIYI
SMKSVIYYFFKNKDQFKKTSQKLNSYYIIQLLMTIICIFTTHIQIFTRMISCLPGIYWWL
ANCLLNDWLNFNKTLNEKKESLYWTRIWILYGMVQAVLFGAFLPPA

Enzyme Prediction     

No EC number prediction in KTW28757.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	14	406	2.5e-97	0.9828009828009828

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.27e-34	14	406	5	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.58e-20	2	406	15	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSL65897.1|GT76	1.46e-117	1	406	1	302
CAA90590.2|GT76	1.53e-57	12	406	76	464
BCR97098.1|GT76	3.82e-52	33	406	39	464
BCS09572.1|GT76	3.82e-52	33	406	39	464
APA08161.1|GT76	1.74e-49	33	406	39	453

PDB Hits     

KTW28757.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09712|GPI18_SCHPO	2.71e-58	12	406	76	464	GPI mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi18 PE=3 SV=2
sp|Q6C216|GPI18_YARLI	3.64e-50	33	406	29	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	5.36e-44	33	406	38	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	1.49e-40	33	406	56	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	6.71e-39	33	406	45	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.950767	0.049248

TMHMM  Annotations     

Start	End
7	29
105	127
148	170
190	212
219	241
288	310
323	345
350	369
382	404