CAZyme Information: KSA03931.1

Basic Information

• Species: Debaryomyces fabryi
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces fabryi
• CAZyme ID: KSA03931.1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411		46743.60	4.9630

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DfabryiCBS789	6025	N/A	0	6025

• Gene Location: location=LMYN01000004:161047-162282(-)

Full Sequence      

MTLTEAKTLLERIEPNLYGDSTIAKIWGVAIKYLDQPNPPIKTPEYSFGRYEFRDIDHWT
AGFFPGSLYCLLERCKNFSSHFPTDNVNQIKLEYAARWWAEGLFEQAPRTDTHDLGFIIQ
PAFQREYEYSKSSRSLDCLVTAANALASRFDETVGCIRSWDTAVNKRYNFTNKNEDFIVI
IDNMCNLDMLYYVASKTGDLRLSTIATKHAEVTLKNHFRNSEWSSFHVVNYDLNDGSVKA
KFTNQGYADDTTWSRGQSWAVLGFVETYLWTKQKKFLDASIGLAEYFLSKLPDDGVPAWD
FGAPDKEIKDTSAAMICALGLIKIYEATNETGYLISGLRLVNDTINFAYTNESSFRKDGT
VDIGARDTILAEATINNNPDTYERLVSHGLVYADYYFLTIGNKLLQLGLIQ

Enzyme Prediction     

No EC number prediction in KSA03931.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	53	399	2.3e-98	0.9756838905775076

CDD Domains     

KSA03931.1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG87553.1|GH88	2.68e-273	1	411	1	411
SGZ47225.1|GH88	8.55e-207	7	411	4	407
SGZ49613.1|GH88	1.41e-205	7	411	4	407
CAG86543.1|GH88	1.43e-168	4	409	5	412
CAG86548.1|GH88	5.70e-163	10	409	7	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	8.06e-40	21	324	38	319	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	6.32e-33	9	321	22	314	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	6.43e-33	9	321	23	315	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	3.21e-32	9	321	23	315	Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3VXD_A	3.21e-32	9	321	23	315	Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	2.56e-53	59	398	77	388	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	1.37e-34	43	321	54	316	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	3.45e-34	34	321	42	313	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q8E372|UCDH_STRA3	3.31e-32	9	321	23	315	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q9RC92|UGL_BACGL	4.53e-27	50	398	33	358	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000003	0.000045

TMHMM  Annotations     

There is no transmembrane helices in KSA03931.1.