CAZyme Information: KSA03888.1

Basic Information

• Species: Debaryomyces fabryi
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces fabryi
• CAZyme ID: KSA03888.1
• CAZy Family: GT66
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A0V1Q5W4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
837		92083.79	5.0566

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DfabryiCBS789	6025	N/A	0	6025

• Gene Location: location=LMYN01000004:89761-92274(+)

Full Sequence      

MSEFDIESTLAQLTIQEKIGLLAGIDFWHTFAVERLNIPSLRFSDGPNGLRGTKFFDSVP
SACFPCGTALAATFDKDLLFEAGRLMGDEAKHKGAHVVLGPTINIQRGPLGGRGFESFSE
DAHLTGQSAASIINGIQDKGIAATIKHFVCNDLEDQRNSSNSVLTERALREIYLEPFRIA
IKHSNPVALMTAYNKVNGEHVSQSERLIQDILRKEWGWEGTTMSDWYGTYTSKEAIENGL
DIEMPGPSIFRNTTEVAAMVTSKELHIKKIDERVKNVLKLIKYALKSGIPGNAPETSNGN
TPETAALLRKIAHDSVVVLKNDDNILPLSKDDKIAVIGPNAKYAAYCGGGSAALRAYYTT
TPFDSISKKLNNEPEYTIGAYGHRLLPALGPQLINPKTGKAGYNLKFYLEPNSPSKRTLI
DEKDLDLSHIFMVDYYNDKVKDDLFYIDFDGQFTPEETADYEFGLAVLGTAQLFVDDKLV
VDNKTVQERGNSFFNSGSNEVRNSISLEKGKTYSIRIEFGSAPTFTAPSSNSVSFGGGGG
INLGLARVINPEEEISKAAELAKKVDKVVLNIGLNQEWESEGFDRPDMKLTGYTNKLVEA
VLDANPNTVIVNQSGTPVEFPWIKKANTLVQAWYGGNEGGNGIADVLFGDVNPNGKLSLS
FPVKNVDNPTYLNFKTENGRVLYGEDIFVGYKYYEKLEREVAFPFGFGLSYTKFDISGLK
VAVSEKDDALEVHVNVKNTGKVDGSEVVQVYISKDESDVIRPVKELKGFEKVNLKAGATS
TVSLKLSLKDSISFFDEYQDEWSVEKGAYTVHVGNSSRDIASTSSFKIEKDFLWSGM

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	245	3.5e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.16e-83	64	824	120	761	beta-glucosidase BglX.
224389	BglX	1.04e-70	26	342	48	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	8.92e-51	316	691	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	9.65e-44	8	784	55	740	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	2.68e-34	64	280	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG85284.2|GH3	0.0	1	837	68	904
ABN67130.1|GH3	0.0	4	836	6	838
CCE84110.1|GH3	0.0	1	836	1	833
CCE85141.1|GH3	0.0	1	836	1	833
QFZ32656.1|GH3	0.0	1	837	1	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ABZ_A	0.0	2	837	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
3AC0_A	0.0	1	837	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
7MS2_A	2.48e-140	5	828	4	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.06e-117	13	831	12	666	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	8.44e-98	6	831	4	716	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07337|BGLS_KLUMA	0.0	1	837	1	845	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|Q9P6J6|BGLS_SCHPO	1.28e-312	1	837	1	832	Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.04 PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	2.23e-307	1	837	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	2.23e-307	1	837	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	5.15e-306	1	837	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999882	0.000133

TMHMM  Annotations     

There is no transmembrane helices in KSA03888.1.