CAZyme Information: KSA03190.1

Basic Information

• Species: Debaryomyces fabryi
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces fabryi
• CAZyme ID: KSA03190.1
• CAZy Family: GT39
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	LMYN01000013|CGC1	40442.13	8.2095

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DfabryiCBS789	6025	N/A	0	6025

• Gene Location: location=LMYN01000013:84188-85234(-)

Full Sequence      

MRKEVKYILWGHVMLVMFLVWYTFDLITLLHDDSFSDALLDVELNPTNGVLDKPTIIPKI
IHQTYKTNQIPEIWKPGQQACVDLHPDYQYILWTDEMSREFIAEEYPWFLETWDSYPYPI
QRADAIRYFALVHYGGVYIDLDDGCERPLDPLLTVSAFVRKTIPTGISNDVMGAVPRHPF
FLKVLDSLKPYKKNWLVPYVTIMYTTGPLFLSVIWKQYKRWGVPEAGKVRILLPEDYKTH
KYSFFAIAPGSSWHLDDAKFVKSLADHIGLAVFGGFVIAGIFFFVEYLLYLLVISNGFKK
CMKRVTSVFAPLNKYVPLNVRSRTLKKRSRKDSNLPPEVDFDNDKTMV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	74	154	1.3e-23	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.06e-79	20	288	29	312	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.40e-27	71	153	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG85453.1|GT32	2.91e-252	1	348	1	348
ABN66494.2|GT32	4.90e-198	1	338	1	336
CCE85744.1|GT32	1.66e-191	1	339	1	337
CCE86854.1|GT32	1.36e-190	1	339	1	337
QRG37334.1|GT32	8.77e-185	1	348	1	338

PDB Hits     

KSA03190.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	4.78e-138	1	334	1	350	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	4.22e-135	1	341	1	362	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	9.60e-88	34	276	60	304	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	1.73e-85	57	290	57	288	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	3.19e-54	33	259	42	267	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999998	0.000027

TMHMM  Annotations     

Start	End
7	29
272	294