CAZyme Information: KSA02893.1

Basic Information

• Species: Debaryomyces fabryi
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces fabryi
• CAZyme ID: KSA02893.1
• CAZy Family: GT34
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	LMYN01000018|CGC1	46725.38	9.6070

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DfabryiCBS789	6025	N/A	0	6025

• Gene Location: location=LMYN01000018:71543-72745(-)

Full Sequence      

MNFNKRKRPIVISIIVIVILLILTKLLTLPKSSENFLKVLQNIPNENILGISKLIYNENE
KTQDEFLSKLEKLNKKLIAKQDERLIHLEKMNENLVNQIRVLKNQNPNLSLRDKLIFLYP
YEPDTRFPAYIWQTWKHGLNDENFGTKYKEGEQQWAYKNPGFVHEIFNDDTAHTVIKHLY
SSVPEVIKAYELMPEIILRMDFFRYLILFAKGGVYADIDTYPLQPVPNWIPENVAPLELG
MIISVETDSNLNKWRQELARRLQFGQFIMQAKPGHPILREIISQITEKTLKLKLKEEEIP
NDLKLTGSSNQKTLKILKWTGSGIWTDVIMNYFNNYIQSSIYQKITWQEFHDLTIPKLVS
DVLVLPISSFASQLEIPKNGKINDPLAFAKHYSSKIWKTT

Enzyme Prediction     

No EC number prediction in KSA02893.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	149	232	4e-22	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.19e-39	69	394	24	343	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.25e-17	153	233	9	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG89506.2|GT32	2.62e-263	1	400	1	400
CCE86889.1|GT32	4.03e-207	1	400	1	400
CCE85777.1|GT32	3.63e-203	1	398	1	398
ABN66691.2|GT32	2.59e-194	4	400	7	402
CCE39846.1|GT32	2.98e-169	39	399	67	430

PDB Hits     

KSA02893.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P47124|HOC1_YEAST	1.22e-98	38	400	43	390	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	2.30e-71	110	398	82	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	2.47e-57	95	398	64	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.75e-53	112	398	129	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.972022	0.027998

TMHMM  Annotations     

Start	End
9	28