CAZyme Information: KSA02134.1

Basic Information

• Species: Debaryomyces fabryi
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces fabryi
• CAZyme ID: KSA02134.1
• CAZy Family: GT15
• CAZyme Description: PA14 domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
836	LMYN01000034|CGC1	93096.45	5.5940

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DfabryiCBS789	6025	N/A	0	6025

• Gene Location: location=LMYN01000034:60362-62872(-)

Full Sequence      

MNPFNDIEKTLAELTDSEKILLIGGKDRFHTAPVERLSIPSIRFSDGPNGVRGKSYFPGV
PSACFPNGTNLGATWDKSLMYEAGKLMGIESKYKGAHAILGPTINIQRSPLGGRGYESYS
EDPVLSGSLATSIINGIQSQNVAACVKHYVCNDIEDDRRAININITERALREIYLLPFEL
AVKNSKPRMVMTSYSKVRGEHVAESKYLLCDILRDEWKWEGTTISDWGGTYSTAEAITNG
LDLEMPGPPIFRRQDLVYISKISKKISNTSFNNRVRNMLRLIKYCIESGVPENAPESSEN
NTEATAKKLRCFSNSGIVLLKNDGGILPLDKKDKIAVIGPNAKNTSISGGGSAALNSYEV
TNIYEAILAKLGYSPEYTVGAHGHKFLPPLGSKLKRDDNSTGYTAKVYLEPSSCKNRTLI
DEFRLTESYLRMPDYENDRISNNLFYVDFEGNFIPDSDGEYEFGLIVVGTVQLFIDGNLL
VDNKTTQKRGTSFYEQGTVEVKNSIYLQKGSSYKIKIEFGSGPTSKINDFLDSLVDGRGA
VGFGVAKVIDPEKEISRAVSIAKRNDTVVLVVGLSKEWESENFDRPDMKLPGYIDRLVSQ
VAQANPNTIVVNQSGTPVEFPWLNEVPGLIQAWFGGTEAGNAVADVIFGDVNPSGKLPLT
FPIKVQDNPTFVNFKSNKGELLYGEDVFVGYRFYEKCEKNVAFPFGFGLSYSKFEFKELN
SLSIKDGNLKFNVLVKNSGNRNGSEVVQVYIKALSPGIERPLKELKDFQKVYLKVKEENN
VHFEIEIKRSTSYWDSLENQWLSESGEYDILIGNSSENILLKTSFRLDTNMYWLLD

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	246	2.5e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.24e-68	65	816	120	754	beta-glucosidase BglX.
224389	BglX	8.24e-65	36	361	57	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	5.50e-59	317	711	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.57e-45	40	786	99	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	6.77e-35	65	281	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG85284.2|GH3	0.0	1	833	68	901
ABN67130.1|GH3	0.0	6	834	7	837
CCE84110.1|GH3	1.06e-311	6	834	5	832
CCE85141.1|GH3	1.06e-311	6	834	5	832
CDR44766.1|GH3	1.65e-304	6	833	5	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.55e-275	6	833	5	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	8.73e-271	6	833	5	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.56e-135	6	831	4	672	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.44e-111	13	828	11	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.01e-100	7	827	4	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P6J6|BGLS_SCHPO	1.91e-286	5	833	4	829	Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.04 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.09e-271	6	834	5	836	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	2.19e-271	6	834	5	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	4.39e-271	6	834	5	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|P07337|BGLS_KLUMA	1.27e-269	6	833	5	842	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.938349	0.061683

TMHMM  Annotations     

There is no transmembrane helices in KSA02134.1.