CAZyme Information: KSA02051.1

Basic Information

• Species: Debaryomyces fabryi
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces fabryi
• CAZyme ID: KSA02051.1
• CAZy Family: GT15
• CAZyme Description: Glyco_hydro_3 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A0V1Q0T9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1045		116864.67	6.7744

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DfabryiCBS789	6025	N/A	0	6025

• Gene Location: location=LMYN01000036:41203-44340(+)

Full Sequence      

MSESSSQKFHAGQLLCGGFQGTNVTAQAYHLIVQHHVSAMILSKKNAVSVKQMTKLIRDL
QYIAYTQGNYKYPLLFAIDEEGGMMNSLFDPDFLNQFPGAMAQAATGDTDLVYKILKAIA
MELKHIGFLIILGPVLDVVTKLSHQLVGVRSFGTTVEDVTKYGKACARGLKDGGLMTVGK
HFPGIGNASVDSLLELPMMADSLDQIKHFNSVPFAELIKEGLLDGISAAGCGVPTISPDE
THACLSPIVINQLLRQDLGFDGMVISECLEMDALYHSIGLGQGVILALYAGCDLVMVCHD
KAFQDEAVESIDKALANGNLDDEIISACLRRIENLQKNLPTWNELFPKGEESAKEDNLPL
FKDRYQETWKQHQTLSQLSYRKSITLVRDYTGTLPITKIFENTQLSSSADDTTNNILLLT
PLLNPIYPTNHGGNGEPQLYTGEEVFQKFGDTLSNHSKNLNSKNPFNVLHTTYTANGLTA
LHESLIENSKAVIVLTSEASRNMYQIGIVKYISILCGANPSSFNNAATSHSQLAKPLIIV
ATLSPYDFFYNKSIGSAYLCCYDYTNNVLRELVSVLMGDIQAEGCIPGEKKFVGKLRKRK
SIDSQNAIEKHNQLKERRISQPKRRWLVDEFDLKRDWAGLVNIWKSNTDTSSNVDYLNVN
VSNNQSGEIAYQDEFFYKKIYQLLSTTANTQKHFVIRNSSLNILYGFVLTWVDDSQGVPL
DGDLTNMDNIQKKTGSIMYLLVDKSKRLQSIGKNLHARAIRYLTKEQKCTRITLGCSFPL
LVFPKNSNLLTNNKVVSFMNNVGWNISNNNSKKKHIMVLYDLNNWLVPKKIFRELTIVGV
RFDVCTDAQKLMNLIHNSSLQDNQLIVNDIRLEMRMKDERDNTKELYIEAIKYLTNSHSY
GVKIIIALEPTNQNVIGSIILFTNKSQMSKFYPFLEECLKDSKTTYNQNLQDPLIGAIMA
PVIDPSYSNLTEIINFGLICSAITFAKSGFNDNDQNQMHKCVMVGINGDNPGNISGIKEI
GFEEWKYFYDFYDSKGEAGKSFLGE

Enzyme Prediction     

No EC number prediction in KSA02051.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	69	297	5.9e-45	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.36e-62	11	399	7	353	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	6.20e-51	12	335	7	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.21e-32	21	379	10	333	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG88375.2|GH3	0.0	1	1045	1	1044
ABN65475.2|GH3	0.0	1	1043	1	1009
CCE81298.1|GH3	0.0	1	1045	1	1044
CCE80533.1|GH3	0.0	1	1045	1	1044
CAX39562.1|GH3	0.0	9	1032	4	945

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	1.36e-59	12	831	14	702	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	3.24e-53	8	337	14	338	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.75e-31	22	395	71	446	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.56e-31	22	395	45	420	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.23e-31	22	395	75	450	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	9.01e-31	22	395	71	446	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q5QUZ5|NAGZ_IDILO	1.10e-30	21	315	10	291	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1
sp|Q606N2|NAGZ_METCA	3.73e-28	21	317	6	288	Beta-hexosaminidase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) OX=243233 GN=nagZ PE=3 SV=1
sp|Q6LJ30|NAGZ_PHOPR	2.28e-27	21	312	10	285	Beta-hexosaminidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=nagZ PE=3 SV=1
sp|P48823|HEXA_PSEO7	4.57e-27	22	340	49	384	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KSA02051.1.