CAZyme Information: KSA01752.1

Basic Information

• Species: Debaryomyces fabryi
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces fabryi
• CAZyme ID: KSA01752.1
• CAZy Family: GH88
• CAZyme Description: Chitin synthase [Source:UniProtKB/TrEMBL;Acc:A0A0V1PZP3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1024		116662.82	5.8744

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DfabryiCBS789	6025	N/A	0	6025

• Gene Location: location=LMYN01000044:44135-47209(+)

Full Sequence      

MSGINKADISDDDDLFGDESRRSSFEQGDYEEQPVSNPFYFNQFQPHQQYSAPQSQSGNL
QVMQPPMHGHQHQGSASTFVDEDNDYFTEKLGSEASLSTSSTFPKRSKTVAFREAEPEYP
PIAYSPGKTMHHYAEPLHYDMERVDTYDFDNPSMALRPYSQVLTFTGDDYMINPLEDADD
DEDLDPFGDDESLFLETGEEIIRRGTTIKRANTTLSRKNTLKRKNSMETGLSLVDEEDDF
KPRLNYTKTIKKAKLVNGNYVIDAPAPKSLLDTYGRKITDSGREMSFMRYTAVTCGPSNF
MNFKYNIRQALYSPPRETEIMVCITMYNEDEILLARTLKGIFDNIKNLTNRNDSKWGDDS
WKKIVVCIISDGRVDLNKRSQELLTALGVYQDGYAKSKINDKSVKSHIYEYTSTVGIETI
NDKIHFCTNSSPVQFLFCLKEKNTRKINSHRWCFQSFAPILNPKVIMLLDCGTKPSKDAF
YHLWKSFNDPNVAGACGEMRAALGPNRKHLANPLVAAQNFEYKISNVLDKPMESVFGFIS
VLPGAFSAYRYEALLNVNGEGPLEKYFKGEFLHQETQVNEDEEDDEKTLKEKNFQEAGIF
TSNMYLAEDRILCFELVAKKNHNYVLRYVNEAKAETDVPEMIDEFVLQRRRWLNGSLFAA
AYAVFHWTKIWKSNHSLLRKLFLQLEFYYQLITLLVSWFSIASFFLVFRILTANLGAKDM
DFDVGKYLAVVFLWFYVGSVVCTFVLSFGNTPRGTRKFYLVIACIFAVLMIYMLFAAIFL
AVHTVQAALESHKDDFTASLLFTDTKFRDLIVSVASTYALYFIASLMYGEPSFMVTSFIQ
YLLLSPSYINILNIYSFCNIHDVSWGTKGSVQAKDLGSAKSADNDKENIVTIVPGVSEEL
NETYLNTLESLRTLPPPPLEINNKKQKDDSYYAFIRTITVLVWMLTNAILIAIVLEAGGV
DTLTSSDSTSISGNSEIFLTIILWIVAGLAAFRFCGSSIYLILKVFRPLKWRIRAKKAAR
KQNY

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	326	487	7.2e-67	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.49e-92	326	487	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	5.59e-84	322	659	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	5.73e-32	436	783	115	414	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
400626	Chitin_synth_1N	6.46e-31	252	325	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
133045	CESA_like	8.52e-18	324	559	3	171	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAR65388.1|GT2	0.0	1	1024	1	1025
CCE88676.1|GT2	0.0	8	1023	9	1035
CCE79393.1|GT2	0.0	68	1023	75	1035
ABN64422.2|GT2	0.0	163	1017	1	857
AOW28121.1|GT2	0.0	106	1023	149	1102

PDB Hits     

KSA01752.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30572|CHS2_CANAX	1.64e-287	247	1010	234	1002	Chitin synthase 2 OS=Candida albicans OX=5476 GN=CHS2 PE=2 SV=2
sp|P30601|CHS2_EXODE	4.18e-252	115	1013	19	925	Chitin synthase 2 OS=Exophiala dermatitidis OX=5970 GN=CHS2 PE=3 SV=2
sp|P30583|CHSC_EMENI	6.21e-240	248	1007	175	916	Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsC PE=3 SV=3
sp|P08004|CHS1_YEAST	3.48e-236	250	1012	375	1131	Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHS1 PE=1 SV=2
sp|P30588|CHS3_NEUCR	1.06e-235	248	1007	148	886	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

Start	End
686	708
727	749
759	781
810	828
838	860
932	954
981	1003