CAZyme Information: KSA01694.1

Basic Information

• Species: Debaryomyces fabryi
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces fabryi
• CAZyme ID: KSA01694.1
• CAZy Family: GH88
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	LMYN01000046|CGC1	38854.76	4.7931

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DfabryiCBS789	6025	N/A	0	6025

• Gene Location: location=LMYN01000046:52943-54061(+)

Full Sequence      

MLFKSFVSAALVGAVLAQPLQQHQHHEHKMEKKDVKVVTQTSVVKVTVGANTYTEPIQVS
TSAVDVTSATEAAQIRPSSFSNPSTFETQTTTGSASESTGASSSSSGSESSSSGVGAGGA
KGITYTPYSNDGGCKSSSQIQKEVSQLSGFDIIRLYGVDCDQVAQVLSAKTSSQKVFAGI
YDVSNIESGIESLASAVKSSGSWDDIYTVSIGNELVNNGEATASQIGEYVKTGKAALKSA
GYTGKVVSVDTFIAVINNPDLCDHSDYIAVNAHAFFDGHVSAEQAGTWVLQQIQRVATAC
GGSKDVFITETGWPSKGDSNGVAVPSTSNQKSAIDSIKDTCGDAVTLFTAFNDLWKADGA
YNAEKYWGIYSS

Enzyme Prediction     

No EC number prediction in KSA01694.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	123	371	1e-25	0.954983922829582

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.67e-97	121	372	46	303	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	6.85e-07	169	372	60	299	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG86316.1|GH17	8.13e-230	1	372	1	372
CAX44189.1|GH17	5.48e-158	1	372	1	373
AAV03539.1|GH17	3.94e-152	1	372	32	409
CAC19886.1|GH17	7.54e-150	1	372	1	379
ABN67223.1|GH17	2.16e-149	1	372	1	369

PDB Hits     

KSA01694.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	2.45e-148	1	372	1	378	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	2.76e-125	1	372	1	388	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	3.43e-115	117	372	130	385	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|B0Y9Q9|BTGE_ASPFC	1.81e-53	119	372	307	563	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	1.81e-53	119	372	307	563	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000324	0.999659	CS pos: 17-18. Pr: 0.9757

TMHMM  Annotations     

There is no transmembrane helices in KSA01694.1.