CAZyme Information: KSA00992.1

Basic Information

• Species: Debaryomyces fabryi
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces fabryi
• CAZyme ID: KSA00992.1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	LMYN01000067|CGC1	39846.15	4.3813

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DfabryiCBS789	6025	N/A	0	6025

• Gene Location: location=LMYN01000067:18808-19962(-)

Full Sequence      

MKYSVLTILALASASLAAPLEGHQHHQHQHKRANVVKQVTQVVYVDSNGNPITSSGTATS
TQGSGSATTLSTVTSSGASSSSSQAASSSASETESESSSTGGSSSGSSSGISGDLSAFSD
PTKKFEDGKYKCSEVPTGQGVIAVDWISGLNGGWTSIMNEDGDTSSNCQDGYYCSYACQA
GMSKTQWPSEQPSNGISVGGLYCKGGYLYKSNQDEDYLCSWGEQTAEFSSEISKDIAICR
TDYPGSENMNIPTLLEGGNTAPASVVDSATYYTWKGGKTSTQYYVNNAGVSVEDGCIWGT
EGSGVGNWAPVVLGAGVTDGKTYLSLIPNPNNQDAPNYNVKIVGESGADVNGDCKYENGS
YNGKGTDGCTVTVSSGKAKFVFYN

Enzyme Prediction     

No EC number prediction in KSA00992.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	83	383	9.1e-127	0.9801980198019802

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	1.35e-132	127	370	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG86368.1|GH132	3.93e-227	1	384	1	384
CAX45649.1|GH132	5.63e-170	1	383	1	371
AOW26995.1|GH132	2.36e-169	1	383	1	372
CCE42652.1|GH132	6.88e-167	1	383	1	384
CCG23148.1|GH132	7.64e-167	1	383	1	387

PDB Hits     

KSA00992.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AKU5|UTH1_CANAL	4.20e-170	1	383	1	372	Secreted beta-glucosidase SIM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SIM1 PE=1 SV=1
sp|Q59NP5|SUN41_CANAL	7.38e-128	113	384	149	418	Secreted beta-glucosidase SUN41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUN41 PE=1 SV=2
sp|P40472|SIM1_YEAST	8.45e-128	113	384	207	476	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2
sp|B3LRC2|UTH1_YEAS1	1.73e-125	125	383	106	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1
sp|A7A003|UTH1_YEAS7	1.73e-125	125	383	106	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=UTH1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000243	0.999752	CS pos: 17-18. Pr: 0.9798

TMHMM  Annotations     

There is no transmembrane helices in KSA00992.1.